(data stored in ACNUC7421 zone)

EMBL: CP000431.PE182

CP000431.PE182       Location/Qualifiers
FT   CDS             complement(240176..240478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00182"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92018"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB8"
FT                   /protein_id="ABG92018.1"
FT                   /translation="MINARRTIAAVAFAALPVLSAFGAASVAHAEPIGPNGPTGGPCPI
FT                   VNTDSQGNETVTYGKPGDRNGALVCGADGEWTVGKAGGFKGGPGQIQTQPGLSRG"
     MINARRTIAA VAFAALPVLS AFGAASVAHA EPIGPNGPTG GPCPIVNTDS QGNETVTYGK        60
     PGDRNGALVC GADGEWTVGK AGGFKGGPGQ IQTQPGLSRG                             100
//

If you have problems or comments...

PBIL Back to PBIL home page