(data stored in ACNUC7421 zone)

EMBL: CP000431.PE184

CP000431.PE184       Location/Qualifiers
FT   CDS             241083..242567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00184"
FT                   /product="possible multidrug efflux transport protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_component: GO:0019866 - organelle inner membrane;
FT                   GO_function: GO:0015520 - tetracycline:hydrogen antiporter
FT                   activity; GO_process: GO:0015904 - tetracycline transport;
FT                   GO_process: GO:0046677 - response to antibiotic"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00184"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92020"
FT                   /db_xref="GOA:Q0SKB6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92020.1"
FT                   /translation="MTSHPPLDLESTRDFSVVCMTSTAPSPASWSELLGPRCRSTSAVL
FT                   AGGVGLHAVNIFLTTSLLPTAIGELGRESLYAWSATVFMVASVISSMTVSRLLAHRGAL
FT                   GAYLFALVPFFVGTMICAVSPSMEVLLVGRAVQGVGGGLLAGLGYAVLREALPEHLWAR
FT                   ATALVSAMWGVGTLAGPAIGGLFAQLGQWRLAFVALAVVTAAIAVIAPRALPRTERVRG
FT                   GEPVPATSLVLLTLATIAISVASIVGNRTHMLALIAVGAAFIVLFLAWERRSPRRVLPQ
FT                   STYTRASSLKWIYLTIAVLASGTVSEAFTPLFGQRLAGLVPFAAGFLGAMMSVGWSATM
FT                   IFSSDISRQRAQTAAKIAGPAVLAAGLLLTAALWRDAAGPVTVILWAGTLAIAGAGIGL
FT                   AFPHLMVAAMRSTDDEQEGAKAAAGLNTVELIAMAVGSAVAGVLVNLGAPSTLASARLL
FT                   FLGLGVIAAVGVFTAYRATRQAEREDAGRPYVRDAK"
     MTSHPPLDLE STRDFSVVCM TSTAPSPASW SELLGPRCRS TSAVLAGGVG LHAVNIFLTT        60
     SLLPTAIGEL GRESLYAWSA TVFMVASVIS SMTVSRLLAH RGALGAYLFA LVPFFVGTMI       120
     CAVSPSMEVL LVGRAVQGVG GGLLAGLGYA VLREALPEHL WARATALVSA MWGVGTLAGP       180
     AIGGLFAQLG QWRLAFVALA VVTAAIAVIA PRALPRTERV RGGEPVPATS LVLLTLATIA       240
     ISVASIVGNR THMLALIAVG AAFIVLFLAW ERRSPRRVLP QSTYTRASSL KWIYLTIAVL       300
     ASGTVSEAFT PLFGQRLAGL VPFAAGFLGA MMSVGWSATM IFSSDISRQR AQTAAKIAGP       360
     AVLAAGLLLT AALWRDAAGP VTVILWAGTL AIAGAGIGLA FPHLMVAAMR STDDEQEGAK       420
     AAAGLNTVEL IAMAVGSAVA GVLVNLGAPS TLASARLLFL GLGVIAAVGV FTAYRATRQA       480
     EREDAGRPYV RDAK                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page