(data stored in ACNUC7421 zone)

EMBL: CP000431.PE186

CP000431.PE186       Location/Qualifiers
FT   CDS             complement(243513..243800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00186"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92022"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92022.1"
FT                   /translation="MQKKSARRTAALVGILSAPLVLGATVGAGTASAEPWHIGPVYRAE
FT                   TSGEGAEYFCGKAAALEQTSGAVIVPCTFDEPTNVWYRVVFNPASWGFDF"
     MQKKSARRTA ALVGILSAPL VLGATVGAGT ASAEPWHIGP VYRAETSGEG AEYFCGKAAA        60
     LEQTSGAVIV PCTFDEPTNV WYRVVFNPAS WGFDF                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page