(data stored in ACNUC7421 zone)

EMBL: CP000431.PE187

CP000431.PE187       Location/Qualifiers
FT   CDS             complement(243868..244497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00187"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005576 - extracellular region;
FT                   GO_component: GO:0016020 - membrane; GO_function:
FT                   GO:0004222 - metalloendopeptidase activity; GO_process:
FT                   GO:0006508 - proteolysis; GO_process: GO:0016998 - cell
FT                   wall catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00187"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92023"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB3"
FT                   /protein_id="ABG92023.1"
FT                   /translation="MTTRNMEKYTLGWIALIGAVVTVLLGLGAGTAGGAPHDWEEVAEC
FT                   ESGGDWTTDTGNGFYGGLQFTPETWKANGGTGVASEASQAEQIRVAENVLKTQGPGAWP
FT                   VCGQYLKKGGTAPVEVPHTTPAPAPAIETPDPVETPDLVETPDVVETPDVVETPDVVEA
FT                   PATVDDSAAVKAAVKAAAQEALNSARELAEQNGSGQVFEERASAPR"
     MTTRNMEKYT LGWIALIGAV VTVLLGLGAG TAGGAPHDWE EVAECESGGD WTTDTGNGFY        60
     GGLQFTPETW KANGGTGVAS EASQAEQIRV AENVLKTQGP GAWPVCGQYL KKGGTAPVEV       120
     PHTTPAPAPA IETPDPVETP DLVETPDVVE TPDVVETPDV VEAPATVDDS AAVKAAVKAA       180
     AQEALNSARE LAEQNGSGQV FEERASAPR                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page