(data stored in ACNUC7421 zone)

EMBL: CP000431.PE188

CP000431.PE188       Location/Qualifiers
FT   CDS             complement(244980..245843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00188"
FT                   /product="probable transcriptional regulator, LuxR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0000156 - two-component response regulator
FT                   activity; GO_function: GO:0003700 - transcription factor
FT                   activity; GO_process: GO:0000160 - two-component signal
FT                   transduction system (phosphorelay)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00188"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92024"
FT                   /db_xref="GOA:Q0SKB2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB2"
FT                   /protein_id="ABG92024.1"
FT                   /translation="MRVPVNDTLRPSDTDAIRAELRDLRRQTDFPVLFGGTVEGGHLTL
FT                   SGFVGTRSTILRDLVIDAECGVGGRAIAEQRPIGIQDYSNSESITHEYDVQVGAEGIET
FT                   LLAVPVVVRGRTRGTLYGGLRANRPLGDRVTDRVMRGAARLARELDIRDEVDRRLAMLA
FT                   ASSGVDRGVPRDVRVSEAITESYLALRDIADRLGDDGLGAEVQAVEQKLRRLTAPGDPS
FT                   TVTLSRRESDVLAHVALGCRNAEIADRLSLSVETVKSYMRNLMGKLEVRSRQEAVVEAR
FT                   RQGLLP"
     MRVPVNDTLR PSDTDAIRAE LRDLRRQTDF PVLFGGTVEG GHLTLSGFVG TRSTILRDLV        60
     IDAECGVGGR AIAEQRPIGI QDYSNSESIT HEYDVQVGAE GIETLLAVPV VVRGRTRGTL       120
     YGGLRANRPL GDRVTDRVMR GAARLARELD IRDEVDRRLA MLAASSGVDR GVPRDVRVSE       180
     AITESYLALR DIADRLGDDG LGAEVQAVEQ KLRRLTAPGD PSTVTLSRRE SDVLAHVALG       240
     CRNAEIADRL SLSVETVKSY MRNLMGKLEV RSRQEAVVEA RRQGLLP                     287
//

If you have problems or comments...

PBIL Back to PBIL home page