(data stored in ACNUC7421 zone)

EMBL: CP000431.PE189

CP000431.PE189       Location/Qualifiers
FT   CDS             245955..247559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00189"
FT                   /product="acyl CoA synthetase, AMP-binding protein"
FT                   /note="GO_function: GO:0016208 - AMP binding; GO_function:
FT                   GO:0016874 - ligase activity; GO_process: GO:0006869 -
FT                   lipid transport; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00189"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92025"
FT                   /db_xref="GOA:Q0SKB1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB1"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92025.1"
FT                   /translation="MSGPTLSTANHTPLSPLRFLERSASVFPDRIAVVHGDRRYSYREF
FT                   GDEVERLARVLRSRIEPGDRVAFLCPNTPEMLFAHFAVPLAGGVLIALNSRLAGRELEY
FT                   ILEHSGTSLLFVDSELVGSVATAREAVPSLREVIEIPDSTIARPMVPEGIVTGMYADFL
FT                   AAADDVDGTPLHWGVDDEQQVIAINYTSGTTGKPKGVMYTHRGAYLNSLGETFHNGFAG
FT                   STKYLWTLPMFHCNGWCTPWAVTQAAGTHICLRAVRADAIWDAIDTLGVTHLCGAPAVC
FT                   STIAEAPQAHPVDALRITTAGAPPSPTVIAQLEAIGVTVVHVYGLTEVYGPYTICEYQD
FT                   SWSDRTAEERASLLSRQGVGMVQAENARVVDAQMNDVPADGETMGEIVLRGNNVMLGYY
FT                   RDPEATAEAFAGGWFHTGDLGVMHADGYIQLKDRAKDIVISGGENISTVEVEQAMMTHP
FT                   AVLDVAVVGVPHPKWGERPKAFVIVKKGATVTAEELVEHTRGRIAKFKVPDEIVFPLEL
FT                   PRTPTGKVLKFELRNSN"
     MSGPTLSTAN HTPLSPLRFL ERSASVFPDR IAVVHGDRRY SYREFGDEVE RLARVLRSRI        60
     EPGDRVAFLC PNTPEMLFAH FAVPLAGGVL IALNSRLAGR ELEYILEHSG TSLLFVDSEL       120
     VGSVATAREA VPSLREVIEI PDSTIARPMV PEGIVTGMYA DFLAAADDVD GTPLHWGVDD       180
     EQQVIAINYT SGTTGKPKGV MYTHRGAYLN SLGETFHNGF AGSTKYLWTL PMFHCNGWCT       240
     PWAVTQAAGT HICLRAVRAD AIWDAIDTLG VTHLCGAPAV CSTIAEAPQA HPVDALRITT       300
     AGAPPSPTVI AQLEAIGVTV VHVYGLTEVY GPYTICEYQD SWSDRTAEER ASLLSRQGVG       360
     MVQAENARVV DAQMNDVPAD GETMGEIVLR GNNVMLGYYR DPEATAEAFA GGWFHTGDLG       420
     VMHADGYIQL KDRAKDIVIS GGENISTVEV EQAMMTHPAV LDVAVVGVPH PKWGERPKAF       480
     VIVKKGATVT AEELVEHTRG RIAKFKVPDE IVFPLELPRT PTGKVLKFEL RNSN             534
//

If you have problems or comments...

PBIL Back to PBIL home page