(data stored in ACNUC7421 zone)

EMBL: CP000431.PE19

CP000431.PE19        Location/Qualifiers
FT   CDS             complement(27477..27659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00019"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91855"
FT                   /db_xref="GOA:Q0SKT1"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKT1"
FT                   /protein_id="ABG91855.1"
FT                   /translation="MSDSNTGAAGGGAIYALGIFGAWVWFWQQADAFWEYVLAIIQGLF
FT                   WPAWMVYDVFETLAG"
     MSDSNTGAAG GGAIYALGIF GAWVWFWQQA DAFWEYVLAI IQGLFWPAWM VYDVFETLAG        60
//

If you have problems or comments...

PBIL Back to PBIL home page