(data stored in ACNUC7421 zone)

EMBL: CP000431.PE190

CP000431.PE190       Location/Qualifiers
FT   CDS             247642..248373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00190"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92026"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKB0"
FT                   /protein_id="ABG92026.1"
FT                   /translation="MGEPGVDAFAIFHAANQWVTPMVALDYDVEPGMQHRLLRKLAGRG
FT                   WRDPSPVIDGVDGVTSPVLSLRSLDGRTLLIEDDTDVLFEGVVVPPHGWIDDVRALGAV
FT                   GVIAGAGITSMPDWERQLPRLARESELLGSVATVTLTNAFGREDVNAFAYEVISALRPM
FT                   LPADALHDAGFALEDDRPHRAVIEVVASAARHQVVVPARIFDLVHRRATDRTSFGWRES
FT                   RILRRLLRKVRTDERASNAEV"
     MGEPGVDAFA IFHAANQWVT PMVALDYDVE PGMQHRLLRK LAGRGWRDPS PVIDGVDGVT        60
     SPVLSLRSLD GRTLLIEDDT DVLFEGVVVP PHGWIDDVRA LGAVGVIAGA GITSMPDWER       120
     QLPRLARESE LLGSVATVTL TNAFGREDVN AFAYEVISAL RPMLPADALH DAGFALEDDR       180
     PHRAVIEVVA SAARHQVVVP ARIFDLVHRR ATDRTSFGWR ESRILRRLLR KVRTDERASN       240
     AEV                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page