(data stored in ACNUC7421 zone)

EMBL: CP000431.PE191

CP000431.PE191       Location/Qualifiers
FT   CDS             248615..250018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00191"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0003824 - catalytic activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00191"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92027"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA9"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92027.1"
FT                   /translation="MSRSVAGGASEDAERRAYARVRAGHVNAVHAALEDHLGRLDWPRD
FT                   QIERYRTDRLRALLAHARERSPFHARRLRDLDPSSASLTDLATLPMMTKRDAQDEWDAI
FT                   VTVRDLDRERAERILAEQQWFSYTSGDEQIFSSGGSSGVRGVYVWDWQFYVSAACLAWR
FT                   VQAREERRASSVRSPARLAVLAAGVPPHASTPLFDVPTAPGMETVVIPAGAPFDEIVAA
FT                   VAAARPTHLVGYATVIGRLARATVAGDLKISPARVSTNSEPLLEEDRQAIRDAWSVPIH
FT                   NLWGSTEIGVQAVGCGYGEGLHVCEDEVVLERVDDSGAPVAADAPAARTLATGLANRTF
FT                   PFIRYDLGDQVTLLPGGCACGSAFARVADIGGRRDDDFRYGTTIVPASTFRYVLGADPR
FT                   ISEYQVRQTADGAEIFAVGDPDVAALTPAVTAALRRQGVADPQVRIEVVDHLQRHLASG
FT                   KLQRFIALR"
     MSRSVAGGAS EDAERRAYAR VRAGHVNAVH AALEDHLGRL DWPRDQIERY RTDRLRALLA        60
     HARERSPFHA RRLRDLDPSS ASLTDLATLP MMTKRDAQDE WDAIVTVRDL DRERAERILA       120
     EQQWFSYTSG DEQIFSSGGS SGVRGVYVWD WQFYVSAACL AWRVQAREER RASSVRSPAR       180
     LAVLAAGVPP HASTPLFDVP TAPGMETVVI PAGAPFDEIV AAVAAARPTH LVGYATVIGR       240
     LARATVAGDL KISPARVSTN SEPLLEEDRQ AIRDAWSVPI HNLWGSTEIG VQAVGCGYGE       300
     GLHVCEDEVV LERVDDSGAP VAADAPAART LATGLANRTF PFIRYDLGDQ VTLLPGGCAC       360
     GSAFARVADI GGRRDDDFRY GTTIVPASTF RYVLGADPRI SEYQVRQTAD GAEIFAVGDP       420
     DVAALTPAVT AALRRQGVAD PQVRIEVVDH LQRHLASGKL QRFIALR                     467
//

If you have problems or comments...

PBIL Back to PBIL home page