(data stored in ACNUC7421 zone)

EMBL: CP000431.PE193

CP000431.PE193       Location/Qualifiers
FT   CDS             250511..251125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00193"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0016021 - integral to membrane;
FT                   GO_function: GO:0005554 - molecular function unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00193"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92029"
FT                   /db_xref="GOA:Q0SKA7"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA7"
FT                   /protein_id="ABG92029.1"
FT                   /translation="MTLGTVRLSSAIRDGTHFSWCRTCSRATVRRVAPVEMGAGTANLD
FT                   ERVPRNRGTGSVRHEELRAHFRYPEDLFTVQREMIAKYHVDDPREFFTTNAFWSVPSDP
FT                   IVDDNPHQPPFDVLVGDRGTAQPSFRPAGAIVGHNREFLSSYISAHSDPENYGKISVLQ
FT                   LPTDTLTQGPQQVQNSVISHSMSEESPPRTVRRRMRPRLSS"
     MTLGTVRLSS AIRDGTHFSW CRTCSRATVR RVAPVEMGAG TANLDERVPR NRGTGSVRHE        60
     ELRAHFRYPE DLFTVQREMI AKYHVDDPRE FFTTNAFWSV PSDPIVDDNP HQPPFDVLVG       120
     DRGTAQPSFR PAGAIVGHNR EFLSSYISAH SDPENYGKIS VLQLPTDTLT QGPQQVQNSV       180
     ISHSMSEESP PRTVRRRMRP RLSS                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page