(data stored in ACNUC7421 zone)

EMBL: CP000431.PE194

CP000431.PE194       Location/Qualifiers
FT   CDS             complement(251271..251750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00194"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00194"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92030"
FT                   /db_xref="GOA:Q0SKA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92030.1"
FT                   /translation="MNPGPRGRLCRRCFSCGYRLPILLPRHVDLVRVADCTHGGHTAAV
FT                   GAWPSWWGAVIQLVCGAALFLGLGTRITAFIASGSTAYAYFWSHQPDGVLPIQDNGELS
FT                   AIFCWALFLMIFLGAGALALDRLIARGGRTAQSGDGDDGTAGEQGPTTELREVNA"
     MNPGPRGRLC RRCFSCGYRL PILLPRHVDL VRVADCTHGG HTAAVGAWPS WWGAVIQLVC        60
     GAALFLGLGT RITAFIASGS TAYAYFWSHQ PDGVLPIQDN GELSAIFCWA LFLMIFLGAG       120
     ALALDRLIAR GGRTAQSGDG DDGTAGEQGP TTELREVNA                              159
//

If you have problems or comments...

PBIL Back to PBIL home page