(data stored in ACNUC7421 zone)

EMBL: CP000431.PE196

CP000431.PE196       Location/Qualifiers
FT   CDS             complement(252739..253125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00196"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92032"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA4"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92032.1"
FT                   /translation="MNLIKKSAASVLVAATVTLGAGTAHADPVVPNTGTPALAIPGRHE
FT                   VDKQKALENMLNELGVGWANGGAAGTAIGALMGLGVGCISMFPGSLAGCIIGTPIGAIT
FT                   GAIVGIGQGNPRAQQAIQEYINTP"
     MNLIKKSAAS VLVAATVTLG AGTAHADPVV PNTGTPALAI PGRHEVDKQK ALENMLNELG        60
     VGWANGGAAG TAIGALMGLG VGCISMFPGS LAGCIIGTPI GAITGAIVGI GQGNPRAQQA       120
     IQEYINTP                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page