(data stored in ACNUC7421 zone)

EMBL: CP000431.PE197

CP000431.PE197       Location/Qualifiers
FT   CDS             complement(253283..254422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00197"
FT                   /product="probable sigma factor, includes region 2"
FT                   /note="GO_component: GO:0005634 - nucleus; GO_function:
FT                   GO:0003700 - transcription factor activity; GO_function:
FT                   GO:0003899 - DNA-directed RNA polymerase activity;
FT                   GO_function: GO:0008565 - protein transporter activity;
FT                   GO_function: GO:0016853 - isomerase activity; GO_function:
FT                   GO:0016987 - sigma factor activity; GO_process: GO:0006352
FT                   - transcription initiation; GO_process: GO:0006355 -
FT                   regulation of transcription, DNA-dependent; GO_process:
FT                   GO:0006457 - protein folding; GO_process: GO:0006606 -
FT                   protein import into nucleus; GO_process: GO:0006986 -
FT                   response to unfolded protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00197"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92033"
FT                   /db_xref="GOA:Q0SKA3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKA3"
FT                   /protein_id="ABG92033.1"
FT                   /translation="MLAPRRRAVDRCSRTGVGPTTGGRAESFLVTDMSARTPDAAAADA
FT                   EAADLARARDGDDAAFTRLVGPLRRELHAHCYRMLGSSHDADDALQDALLRAWRGFARF
FT                   EGRSTLRSWLYTVATRTCLDAVESRGRRALPVDLGPSSDRAVIGDVPLTDVAWLGPYAD
FT                   AGLTAGSAGPAARYEQREAVELAFVAALQHLPGNQRAALLLFEVLGFSAAEIADTMNTS
FT                   TASVNSALQRARTIVAEKIPPVTQAHTVREIDDARLRAIVAGYSTALERGDADALVALL
FT                   TEDVTWSMPPMAHWYRGLDAVTDFAVRVPLTGCGSWRHLPVGANGQPAVAFYLWDEDAG
FT                   THLRWSITVLTLRGTKIADLTSFLGPEHFDPFGLPESLP"
     MLAPRRRAVD RCSRTGVGPT TGGRAESFLV TDMSARTPDA AAADAEAADL ARARDGDDAA        60
     FTRLVGPLRR ELHAHCYRML GSSHDADDAL QDALLRAWRG FARFEGRSTL RSWLYTVATR       120
     TCLDAVESRG RRALPVDLGP SSDRAVIGDV PLTDVAWLGP YADAGLTAGS AGPAARYEQR       180
     EAVELAFVAA LQHLPGNQRA ALLLFEVLGF SAAEIADTMN TSTASVNSAL QRARTIVAEK       240
     IPPVTQAHTV REIDDARLRA IVAGYSTALE RGDADALVAL LTEDVTWSMP PMAHWYRGLD       300
     AVTDFAVRVP LTGCGSWRHL PVGANGQPAV AFYLWDEDAG THLRWSITVL TLRGTKIADL       360
     TSFLGPEHFD PFGLPESLP                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page