(data stored in ACNUC7421 zone)

EMBL: CP000431.PE2

CP000431.PE2         Location/Qualifiers
FT   CDS             3556..4122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00002"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00002"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91838"
FT                   /db_xref="UniProtKB/TrEMBL:Q0S090"
FT                   /protein_id="ABG91838.1"
FT                   /translation="MPTVAAHCTLHLVSGPEPPPPSSWSIGTRPDWPSPVSSSPPAASG
FT                   SGGDPRSAARTERVGPERPHRRAACDPPLPPADREEPQCRHPNLTTRRPDDQTIVSLNA
FT                   VRQRTTDDLLSGHVPLTSLLYRRRDRIAADLLVSDVLTTYMRGHGIGPAGVMVMLGIAD
FT                   DARARDPTAEQRGQITDAIAATSER"
     MPTVAAHCTL HLVSGPEPPP PSSWSIGTRP DWPSPVSSSP PAASGSGGDP RSAARTERVG        60
     PERPHRRAAC DPPLPPADRE EPQCRHPNLT TRRPDDQTIV SLNAVRQRTT DDLLSGHVPL       120
     TSLLYRRRDR IAADLLVSDV LTTYMRGHGI GPAGVMVMLG IADDARARDP TAEQRGQITD       180
     AIAATSER                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page