(data stored in ACNUC7421 zone)

EMBL: CP000431.PE203

CP000431.PE203       Location/Qualifiers
FT   CDS             258190..258903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00203"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00203"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92039"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK97"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92039.1"
FT                   /translation="MKTKGQVALAVGAGYMLGRTHRMKMALMLAAAGATGRFPGGPRDL
FT                   LERGTKMLASSPEFAKISDSVREELINAAKAAAVTAASQRINSLNNRLLSSGGEAVGDV
FT                   GDTVDDTVSGVGNSVGKLSRVGKLGRKRRGRSQDDEYDESEVDEEQDEQPDEQYAEEDD
FT                   EYEEPEEEEAAEEEPAPRKRPAARRRTSSSGSSRPAGRSRTAKSDLDDEEAPTRGRKTR
FT                   AKATTDSAPVRRARR"
     MKTKGQVALA VGAGYMLGRT HRMKMALMLA AAGATGRFPG GPRDLLERGT KMLASSPEFA        60
     KISDSVREEL INAAKAAAVT AASQRINSLN NRLLSSGGEA VGDVGDTVDD TVSGVGNSVG       120
     KLSRVGKLGR KRRGRSQDDE YDESEVDEEQ DEQPDEQYAE EDDEYEEPEE EEAAEEEPAP       180
     RKRPAARRRT SSSGSSRPAG RSRTAKSDLD DEEAPTRGRK TRAKATTDSA PVRRARR          237
//

If you have problems or comments...

PBIL Back to PBIL home page