(data stored in ACNUC7421 zone)

EMBL: CP000431.PE204

CP000431.PE204       Location/Qualifiers
FT   CDS             258909..260090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00204"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0016218 - polyketide synthase
FT                   activity; GO_process: GO:0017000 - antibiotic biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00204"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92040"
FT                   /db_xref="GOA:Q0SK96"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK96"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92040.1"
FT                   /translation="MTSAAKKLREAAPGDGDGSSSVLQEAMQRLVGTVAEKALSSVSDK
FT                   VANTSGRLTEYAENGGEGGLLAALTGSEKSDDDESPDESDTGGGWWEGAKQTVKDKASD
FT                   LKDAVTGGGGGGSGKGKKLKLTNIVETIDVGVPVQLAYNQWTQFADFPSFMKKVERVEQ
FT                   EADEKLEWKAQIFLSHRTWEATILEQVPDERIVWRSKGAKGFIDGAVTFHEVTPDLTRI
FT                   VLILEYHPKGLFEKTGNLWRAQGRRARLELKHFARHVMTQSILHPDDVEGWRGEIRDGQ
FT                   VVEPEEDEAETEDEQDESQPDEGEEDETEEPAETDEYEDEEPEAEEDEADEADEGEGED
FT                   EEEEEEEAPPPPRRRGRPRKTAAAAVDQAPKQRGRPRKATATKTSSSRQGARR"
     MTSAAKKLRE AAPGDGDGSS SVLQEAMQRL VGTVAEKALS SVSDKVANTS GRLTEYAENG        60
     GEGGLLAALT GSEKSDDDES PDESDTGGGW WEGAKQTVKD KASDLKDAVT GGGGGGSGKG       120
     KKLKLTNIVE TIDVGVPVQL AYNQWTQFAD FPSFMKKVER VEQEADEKLE WKAQIFLSHR       180
     TWEATILEQV PDERIVWRSK GAKGFIDGAV TFHEVTPDLT RIVLILEYHP KGLFEKTGNL       240
     WRAQGRRARL ELKHFARHVM TQSILHPDDV EGWRGEIRDG QVVEPEEDEA ETEDEQDESQ       300
     PDEGEEDETE EPAETDEYED EEPEAEEDEA DEADEGEGED EEEEEEEAPP PPRRRGRPRK       360
     TAAAAVDQAP KQRGRPRKAT ATKTSSSRQG ARR                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page