(data stored in ACNUC7421 zone)

EMBL: CP000431.PE205

CP000431.PE205       Location/Qualifiers
FT   CDS             260087..260500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00205"
FT                   /product="gas vesicle synthesis protein"
FT                   /note="GO_component: GO:0012506 - vesicle membrane;
FT                   GO_function: GO:0005198 - structural molecule activity"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00205"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92041"
FT                   /db_xref="GOA:Q0SK95"
FT                   /db_xref="InterPro:IPR000638"
FT                   /db_xref="InterPro:IPR018493"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK95"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92041.1"
FT                   /translation="MTSIQPAGGGGGGVSGGPSSSSLADVIDTILDKGLVIDAYVRVSL
FT                   VGIELLTIDARVVVASVDTYLRFAEAVNRLEIGSGEPKGLTDLVGDVTEGGAKSKTKGA
FT                   LESAGEKLGDILGGGKEEPERERVSRKSTRGDK"
     MTSIQPAGGG GGGVSGGPSS SSLADVIDTI LDKGLVIDAY VRVSLVGIEL LTIDARVVVA        60
     SVDTYLRFAE AVNRLEIGSG EPKGLTDLVG DVTEGGAKSK TKGALESAGE KLGDILGGGK       120
     EEPERERVSR KSTRGDK                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page