(data stored in ACNUC7421 zone)

EMBL: CP000431.PE206

CP000431.PE206       Location/Qualifiers
FT   CDS             260500..261288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00206"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00206"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92042"
FT                   /db_xref="GOA:Q0SK94"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK94"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92042.1"
FT                   /translation="MSTSNENTDSAEEPRTSGVYVYGIVPADVQAEEDAVGVCDGPVSI
FT                   VKHGDIAALVSEISVDRPLGKPEDLRTHAHVLDGTSRVAPVLPLRFGAVMTDEGAVEEE
FT                   LLAAHADEFAAALKELEGRAQYVVKGRYVEQAILEEIIEENEQASKLLGAIRDQPEETT
FT                   RDARMALGEIVSNAIEAKRDEDTQKVVEALESLSDSVNVREPTHEEEAAQVAALVEVAR
FT                   QEELEKAVGELAEQWDGRVDMRLLGPLAAYDFVVTQKPEG"
     MSTSNENTDS AEEPRTSGVY VYGIVPADVQ AEEDAVGVCD GPVSIVKHGD IAALVSEISV        60
     DRPLGKPEDL RTHAHVLDGT SRVAPVLPLR FGAVMTDEGA VEEELLAAHA DEFAAALKEL       120
     EGRAQYVVKG RYVEQAILEE IIEENEQASK LLGAIRDQPE ETTRDARMAL GEIVSNAIEA       180
     KRDEDTQKVV EALESLSDSV NVREPTHEEE AAQVAALVEV ARQEELEKAV GELAEQWDGR       240
     VDMRLLGPLA AYDFVVTQKP EG                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page