(data stored in ACNUC7421 zone)

EMBL: CP000431.PE207

CP000431.PE207       Location/Qualifiers
FT   CDS             261292..261546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00207"
FT                   /product="possible gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00207"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92043"
FT                   /db_xref="InterPro:IPR007804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK93"
FT                   /protein_id="ABG92043.1"
FT                   /translation="MGLLSFIATLPLAPVRGVISLAELIQRQVEEEAHNPASARRALEE
FT                   LEDARAAGEISAEEEEQAQQAILDRMTGTARPPSGTEKE"
     MGLLSFIATL PLAPVRGVIS LAELIQRQVE EEAHNPASAR RALEELEDAR AAGEISAEEE        60
     EQAQQAILDR MTGTARPPSG TEKE                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page