(data stored in ACNUC7421 zone)

EMBL: CP000431.PE208

CP000431.PE208       Location/Qualifiers
FT   CDS             261553..261843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00208"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00208"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92044"
FT                   /db_xref="GOA:Q0SK92"
FT                   /db_xref="InterPro:IPR008634"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK92"
FT                   /protein_id="ABG92044.1"
FT                   /translation="MAEEQPPPLPAPEIAEIATHDIAQLTGKKPLGATSVMPTDDGWTV
FT                   EVEVVEDRRIPSSTDMLAMYEVVLDLDGELLSYRRTRRYIRGVGDSGSASS"
     MAEEQPPPLP APEIAEIATH DIAQLTGKKP LGATSVMPTD DGWTVEVEVV EDRRIPSSTD        60
     MLAMYEVVLD LDGELLSYRR TRRYIRGVGD SGSASS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page