(data stored in ACNUC7421 zone)

EMBL: CP000431.PE21

CP000431.PE21        Location/Qualifiers
FT   CDS             27922..28803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00021"
FT                   /product="probable universal stress protein"
FT                   /note="GO_process: GO:0006950 - response to stress"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00021"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91857"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS9"
FT                   /protein_id="ABG91857.1"
FT                   /translation="MSGHRPIVVGIDGSPSSLQAVSWAAREAALRSSPLSLITTMFVPG
FT                   RYGVPIGVPASFFQDEERDGKERLERAAQTARAAVPGHDIEIDTTVCTGTPAGELLDRS
FT                   ADASMLVVGANRRGIVDRAVLGSVSSAVATHASCPVAVIRGEPDRDINDIPGPIVVGVD
FT                   GSQHSEPAISTAFEEAGLRQSELVAVHAWSDIVLQLSPDGGSEAEWLRDAANETALLSE
FT                   NLAGRAENYPDVKVRTLVVRDRPTRHLREQAENAQLLVVGSRGRGGFSSMLLGSTSRAL
FT                   MHSVVCPLLIVR"
     MSGHRPIVVG IDGSPSSLQA VSWAAREAAL RSSPLSLITT MFVPGRYGVP IGVPASFFQD        60
     EERDGKERLE RAAQTARAAV PGHDIEIDTT VCTGTPAGEL LDRSADASML VVGANRRGIV       120
     DRAVLGSVSS AVATHASCPV AVIRGEPDRD INDIPGPIVV GVDGSQHSEP AISTAFEEAG       180
     LRQSELVAVH AWSDIVLQLS PDGGSEAEWL RDAANETALL SENLAGRAEN YPDVKVRTLV       240
     VRDRPTRHLR EQAENAQLLV VGSRGRGGFS SMLLGSTSRA LMHSVVCPLL IVR              293
//

If you have problems or comments...

PBIL Back to PBIL home page