(data stored in ACNUC7421 zone)

EMBL: CP000431.PE210

CP000431.PE210       Location/Qualifiers
FT   CDS             262234..263013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00210"
FT                   /product="probable gas vesicle synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00210"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92046"
FT                   /db_xref="GOA:Q0SK90"
FT                   /db_xref="InterPro:IPR009430"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK90"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92046.1"
FT                   /translation="MTADEGVWLYSITTDRIGDAQLAGVTGVAGEPVRAVSSAGLVAVV
FT                   GTVSLSEFGQEPLQRNLEDLDWLAATARAHDAVVAAVLRCGPTVPLRLATLYLDDDRVR
FT                   LLLDERQDEFGATLRRVTGRSEWGVKAYGDAKALAQNVKEDPAATGAAGKGTAYLLRRR
FT                   AELSAQQDVERRAAGHADEIHSALLGHAVDGVRRQVTDPVLTGKRAWMIFNGTYLVDDE
FT                   RVDDFAALVSALDTARPGITLDLTGPWPPYSFAGIDG"
     MTADEGVWLY SITTDRIGDA QLAGVTGVAG EPVRAVSSAG LVAVVGTVSL SEFGQEPLQR        60
     NLEDLDWLAA TARAHDAVVA AVLRCGPTVP LRLATLYLDD DRVRLLLDER QDEFGATLRR       120
     VTGRSEWGVK AYGDAKALAQ NVKEDPAATG AAGKGTAYLL RRRAELSAQQ DVERRAAGHA       180
     DEIHSALLGH AVDGVRRQVT DPVLTGKRAW MIFNGTYLVD DERVDDFAAL VSALDTARPG       240
     ITLDLTGPWP PYSFAGIDG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page