(data stored in ACNUC7421 zone)

EMBL: CP000431.PE212

CP000431.PE212       Location/Qualifiers
FT   CDS             263220..263552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00212"
FT                   /product="gas vesicle protein, GvpK"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00212"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92048"
FT                   /db_xref="GOA:Q0SK88"
FT                   /db_xref="InterPro:IPR007805"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK88"
FT                   /protein_id="ABG92048.1"
FT                   /translation="MTEPEPVDSDAPTDIGRRVLPQRIDADPESVEKGLVTLVLTIVEL
FT                   LRQLMERQAIRRVEHGDLTDEQIERIGTTLMLLEERMAELREHFDLTPEDLNIDLGPLG
FT                   PLLSNE"
     MTEPEPVDSD APTDIGRRVL PQRIDADPES VEKGLVTLVL TIVELLRQLM ERQAIRRVEH        60
     GDLTDEQIER IGTTLMLLEE RMAELREHFD LTPEDLNIDL GPLGPLLSNE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page