(data stored in ACNUC7421 zone)

EMBL: CP000431.PE216

CP000431.PE216       Location/Qualifiers
FT   CDS             265816..266136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00216"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92052"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK84"
FT                   /protein_id="ABG92052.1"
FT                   /translation="MNTFAVRSALAAAAALAVFATPGVAAAAPNLHGDPTTPGTQVQVE
FT                   SDPGDSNSYTCGAVGVAGAGVGSNSSGGAGQVNGAYFGPGPVQGGCVGSDGSVYFPTGN
FT                   AE"
     MNTFAVRSAL AAAAALAVFA TPGVAAAAPN LHGDPTTPGT QVQVESDPGD SNSYTCGAVG        60
     VAGAGVGSNS SGGAGQVNGA YFGPGPVQGG CVGSDGSVYF PTGNAE                      106
//

If you have problems or comments...

PBIL Back to PBIL home page