(data stored in ACNUC7421 zone)

EMBL: CP000431.PE217

CP000431.PE217       Location/Qualifiers
FT   CDS             complement(266165..266845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00217"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_component: GO:0005737 - cytoplasm; GO_component:
FT                   GO:0016021 - integral to membrane; GO_function: GO:0008119
FT                   - thiopurine S-methyltransferase activity; GO_process:
FT                   GO:0008152 - metabolism; GO_process: GO:0046690 - response
FT                   to tellurium ion"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00217"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92053"
FT                   /db_xref="GOA:Q0SK83"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK83"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92053.1"
FT                   /translation="MSERSGPLADPFSGRQPTSHERMTGRPWDASYHEGPAPWDVGRPQ
FT                   PAVVRVASEGGFAGAVLDAGCGTGENALHVASLGLQVLGVDVAETALAIARDKADDRRI
FT                   EVEFALADAFQLDGMGRRFDTVLDCGLFHTFDAAERPRYVASVASVTEHGGTVYVLCFS
FT                   DAGPDTGPHPVSREELRAAFDPGDGWKVAAIEPDRIETRFHDNGAPAWFATIERIHPVG
FT                   GPAR"
     MSERSGPLAD PFSGRQPTSH ERMTGRPWDA SYHEGPAPWD VGRPQPAVVR VASEGGFAGA        60
     VLDAGCGTGE NALHVASLGL QVLGVDVAET ALAIARDKAD DRRIEVEFAL ADAFQLDGMG       120
     RRFDTVLDCG LFHTFDAAER PRYVASVASV TEHGGTVYVL CFSDAGPDTG PHPVSREELR       180
     AAFDPGDGWK VAAIEPDRIE TRFHDNGAPA WFATIERIHP VGGPAR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page