(data stored in ACNUC7421 zone)

EMBL: CP000431.PE22

CP000431.PE22        Location/Qualifiers
FT   CDS             28827..29423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00022"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91858"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS8"
FT                   /protein_id="ABG91858.1"
FT                   /translation="MHSPGPGSTLIEAQLPRYEQRILRTQAVRASAPATFAAIRRVDFF
FT                   RSPVVALPNRARIAIDTVRPRRGGAPIQRSRSEFRFDRLLEPDGGFHLLAEKPGHAMVL
FT                   GFIGRWWERGYGRVEWSPAEFGRFALPGYGVGAWGFTVLPYGAHTSVLLTEVRVHGTDD
FT                   TARRMFRRYWTVVGPFVTAMGGPILRLIRDEAESR"
     MHSPGPGSTL IEAQLPRYEQ RILRTQAVRA SAPATFAAIR RVDFFRSPVV ALPNRARIAI        60
     DTVRPRRGGA PIQRSRSEFR FDRLLEPDGG FHLLAEKPGH AMVLGFIGRW WERGYGRVEW       120
     SPAEFGRFAL PGYGVGAWGF TVLPYGAHTS VLLTEVRVHG TDDTARRMFR RYWTVVGPFV       180
     TAMGGPILRL IRDEAESR                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page