(data stored in ACNUC7421 zone)

EMBL: CP000431.PE220

CP000431.PE220       Location/Qualifiers
FT   CDS             268396..268773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00220"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92056"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK80"
FT                   /protein_id="ABG92056.1"
FT                   /translation="MPRLQIGVPWPVGGILSAKDVSTCRTLQVEPLDEGVHESGACLHR
FT                   RSVRRGRSRPVTRQIHSDDAVAGLDQRRDLIPPRRGGGCEARRQHHARRGSAVTVHGVV
FT                   DSSTAGFDGQHCFSYPPTVRG"
     MPRLQIGVPW PVGGILSAKD VSTCRTLQVE PLDEGVHESG ACLHRRSVRR GRSRPVTRQI        60
     HSDDAVAGLD QRRDLIPPRR GGGCEARRQH HARRGSAVTV HGVVDSSTAG FDGQHCFSYP       120
     PTVRG                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page