(data stored in ACNUC7421 zone)

EMBL: CP000431.PE221

CP000431.PE221       Location/Qualifiers
FT   CDS             268975..269316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00221"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92057"
FT                   /db_xref="GOA:Q0SK79"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK79"
FT                   /protein_id="ABG92057.1"
FT                   /translation="MHISLPHSQASRAANPSGAVNRRPRITLRNRFATAAVAAAIAVIP
FT                   LGAATTIATAAEHPVATVAAPTIPGDRGDHGDGPRHDRQRDQRQERRDQSMTLDELLIG
FT                   WNSSQIYQM"
     MHISLPHSQA SRAANPSGAV NRRPRITLRN RFATAAVAAA IAVIPLGAAT TIATAAEHPV        60
     ATVAAPTIPG DRGDHGDGPR HDRQRDQRQE RRDQSMTLDE LLIGWNSSQI YQM              113
//

If you have problems or comments...

PBIL Back to PBIL home page