(data stored in ACNUC7421 zone)

EMBL: CP000431.PE222

CP000431.PE222       Location/Qualifiers
FT   CDS             complement(269378..269848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00222"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92058"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK78"
FT                   /protein_id="ABG92058.1"
FT                   /translation="MDDIIDFVEGLGDVLTLRPAPGDGSPEISWGDTFFYYSPDRIVPD
FT                   RTQPFATIVTKNYPGDESSGLDRAGAFRVNIHAGKEAFIEATGHAPREQGVADVDAGAR
FT                   DTVIAHPVYGSLAWLAVIDPGSRTGEVTRALLCRAHALARSRYERRAESTPR"
     MDDIIDFVEG LGDVLTLRPA PGDGSPEISW GDTFFYYSPD RIVPDRTQPF ATIVTKNYPG        60
     DESSGLDRAG AFRVNIHAGK EAFIEATGHA PREQGVADVD AGARDTVIAH PVYGSLAWLA       120
     VIDPGSRTGE VTRALLCRAH ALARSRYERR AESTPR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page