(data stored in ACNUC7421 zone)

EMBL: CP000431.PE223

CP000431.PE223       Location/Qualifiers
FT   CDS             269918..270688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00223"
FT                   /product="possible transcriptional regulator, MerR family
FT                   protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_process: GO:0006355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00223"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92059"
FT                   /db_xref="GOA:Q0SK77"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK77"
FT                   /protein_id="ABG92059.1"
FT                   /translation="MTSLQSRHLRTVDVARRAGCSVQHVRNLERDGVLPPATRTATGYR
FT                   IYTDVHVQSALAYRELAIGVGPVEATRIVRSVHTCPAATTVALLDAAHARLHTERTELA
FT                   LAKQAAEAISTEPVDDVQASDWMSVSELAAALGIRPSTLRHWDAEGLVVPDRDTPTGAR
FT                   RYSPSQVRDARVVHQLRKAGYRIAPLHAVMTQLGHTPGSGDIGAALAARDQATTARSRA
FT                   LLDATSALTVLLALREGGVSARATTPPPENRNPR"
     MTSLQSRHLR TVDVARRAGC SVQHVRNLER DGVLPPATRT ATGYRIYTDV HVQSALAYRE        60
     LAIGVGPVEA TRIVRSVHTC PAATTVALLD AAHARLHTER TELALAKQAA EAISTEPVDD       120
     VQASDWMSVS ELAAALGIRP STLRHWDAEG LVVPDRDTPT GARRYSPSQV RDARVVHQLR       180
     KAGYRIAPLH AVMTQLGHTP GSGDIGAALA ARDQATTARS RALLDATSAL TVLLALREGG       240
     VSARATTPPP ENRNPR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page