(data stored in ACNUC7421 zone)

EMBL: CP000431.PE225

CP000431.PE225       Location/Qualifiers
FT   CDS             271429..271851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00225"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92061"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK75"
FT                   /protein_id="ABG92061.1"
FT                   /translation="MPESVPDRVQITDRLHVVADLLDTKDWPGFAATLTEDVVAYGRTG
FT                   PVDVVARVRSHLDVCGATQHLLGNIRVDVDGDAARTRSYFRAFHVGLGERAGATYECLG
FT                   EYRDEWRRGPSAWLLAGRVIDVRAEIGDRGVIAPLS"
     MPESVPDRVQ ITDRLHVVAD LLDTKDWPGF AATLTEDVVA YGRTGPVDVV ARVRSHLDVC        60
     GATQHLLGNI RVDVDGDAAR TRSYFRAFHV GLGERAGATY ECLGEYRDEW RRGPSAWLLA       120
     GRVIDVRAEI GDRGVIAPLS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page