(data stored in ACNUC7421 zone)

EMBL: CP000431.PE226

CP000431.PE226       Location/Qualifiers
FT   CDS             complement(271866..272957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00226"
FT                   /product="ABC sugar transporter, periplasmic solute-binding
FT                   protein"
FT                   /note="tc: 3.A.1.2; GO_component: GO:0042597 - periplasmic
FT                   space; GO_function: GO:0016491 - oxidoreductase activity;
FT                   GO_process: GO:0006935 - chemotaxis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00226"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92062"
FT                   /db_xref="GOA:Q0SK74"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK74"
FT                   /protein_id="ABG92062.1"
FT                   /translation="MKRRVRAFSVAAAVAAVVLGACAAPAPQGDDAQEKVFFFLPNTTT
FT                   TRFVERDEPLFTDFLELFAPEATVTVRNAEGDPARQQSQVESAIAEGASVLVLISTDAR
FT                   FSGGALTAAAEADVPVVLYDHDAVGGPADVQVIFDPLEVGRRQGSRAADLIAAMPGDGV
FT                   KIARVGGNLGEYGTRQFLLGQDEFLQPLADSGKIRVVCETAIDDWDPAEGQAFAEECLA
FT                   RENNDIALFVTMNDDLGGGIVAALAGRGLAGRIPVTGGQDANLAALQLIAQETLDNTIF
FT                   KNLSDQAKVAAQLTTSILHGDGIPEEIVNGTIDNQYMAVPTVFLPVQNITKDNLDVVVN
FT                   SGFYTWQQICAPDPASAVCGDHS"
     MKRRVRAFSV AAAVAAVVLG ACAAPAPQGD DAQEKVFFFL PNTTTTRFVE RDEPLFTDFL        60
     ELFAPEATVT VRNAEGDPAR QQSQVESAIA EGASVLVLIS TDARFSGGAL TAAAEADVPV       120
     VLYDHDAVGG PADVQVIFDP LEVGRRQGSR AADLIAAMPG DGVKIARVGG NLGEYGTRQF       180
     LLGQDEFLQP LADSGKIRVV CETAIDDWDP AEGQAFAEEC LARENNDIAL FVTMNDDLGG       240
     GIVAALAGRG LAGRIPVTGG QDANLAALQL IAQETLDNTI FKNLSDQAKV AAQLTTSILH       300
     GDGIPEEIVN GTIDNQYMAV PTVFLPVQNI TKDNLDVVVN SGFYTWQQIC APDPASAVCG       360
     DHS                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page