(data stored in ACNUC7421 zone)

EMBL: CP000431.PE227

CP000431.PE227       Location/Qualifiers
FT   CDS             273108..274472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00227"
FT                   /product="possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00227"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92063"
FT                   /db_xref="GOA:Q0SK73"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK73"
FT                   /protein_id="ABG92063.1"
FT                   /translation="MFHQDRGAVSSGDRDTSTADEHLLNESLLVEPEVRRRPWREFLAS
FT                   TPGRLSLLAVVLVAVALTAGLVTSAVVAARQQRMETLRAHTEPLADAAQNLFSSLSIAD
FT                   AAATSSFIAGAIEPLAVRDRYNQALGDASNALVTASYGVTSGDVESLRLLTEMSRHVAV
FT                   YTDLVATARSNDSAGNPVGVAYLGTASALMQDTILPLAEHLYNDQARAVADTQSHTARL
FT                   PATAIVVASAGVVVLAVAHAYVAHRSRRRVNPGLACATVLLAALVVWIVIAGLLSTSAS
FT                   ERARIDGAEPLAAVTKARILAQQARADETLGLLRPGFDPAGSDYARHTDALSAILNSDA
FT                   SRNTVIAPTIADASAAFDGWRSAHRDLQQKLADGDYQGAADVAVGPGATASTAQFRALD
FT                   ESLEDAITALRTEELDAMRESYRTMAALAVGGIVLAVSAALAVVAGIEPRVSEYH"
     MFHQDRGAVS SGDRDTSTAD EHLLNESLLV EPEVRRRPWR EFLASTPGRL SLLAVVLVAV        60
     ALTAGLVTSA VVAARQQRME TLRAHTEPLA DAAQNLFSSL SIADAAATSS FIAGAIEPLA       120
     VRDRYNQALG DASNALVTAS YGVTSGDVES LRLLTEMSRH VAVYTDLVAT ARSNDSAGNP       180
     VGVAYLGTAS ALMQDTILPL AEHLYNDQAR AVADTQSHTA RLPATAIVVA SAGVVVLAVA       240
     HAYVAHRSRR RVNPGLACAT VLLAALVVWI VIAGLLSTSA SERARIDGAE PLAAVTKARI       300
     LAQQARADET LGLLRPGFDP AGSDYARHTD ALSAILNSDA SRNTVIAPTI ADASAAFDGW       360
     RSAHRDLQQK LADGDYQGAA DVAVGPGATA STAQFRALDE SLEDAITALR TEELDAMRES       420
     YRTMAALAVG GIVLAVSAAL AVVAGIEPRV SEYH                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page