(data stored in ACNUC7421 zone)

EMBL: CP000431.PE228

CP000431.PE228       Location/Qualifiers
FT   CDS             274472..275461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00228"
FT                   /product="ABC amino acid transporter, periplasmic substrate
FT                   binding protein"
FT                   /note="tc: 3.A.1.3; GO_component: GO:0016020 - membrane;
FT                   GO_component: GO:0030288 - periplasmic space (sensu
FT                   Proteobacteria); GO_function: GO:0000287 - magnesium ion
FT                   binding; GO_function: GO:0004970 - ionotropic glutamate
FT                   receptor activity; GO_function: GO:0005234 -
FT                   glutamate-gated ion channel activity; GO_process:
FT                   GO:0006810 - transport"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00228"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92064"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK72"
FT                   /protein_id="ABG92064.1"
FT                   /translation="MVRTHPERRPRSTRLLGCLAFGAVLIAGCGAPDAPAPRFSGDFTE
FT                   FPLSAGAQLIAPSDTPPPDTETPACAAPASLRPGTPSFGGTLGDIRARGTVVVAVDQNT
FT                   NLFSFRDPTTGTLTGFGVDLAREVARDLLGDPTKVEFRPLGTDDGAEMLADRDADMVVR
FT                   PVALPCQGLQDLTFSTVYLEASRRLVVRDGSGISGPADLARRRVCTHHDPASMSALSRI
FT                   APKATILAVPDWDDCLMAIQQRQADAVAGAAFLAGLVAQDPNLEIVGPETDSAQYAIGL
FT                   APGNDDLVRFVNGTLERLRTDGTWAALYERWLSSLGPAPGPPAPEYRD"
     MVRTHPERRP RSTRLLGCLA FGAVLIAGCG APDAPAPRFS GDFTEFPLSA GAQLIAPSDT        60
     PPPDTETPAC AAPASLRPGT PSFGGTLGDI RARGTVVVAV DQNTNLFSFR DPTTGTLTGF       120
     GVDLAREVAR DLLGDPTKVE FRPLGTDDGA EMLADRDADM VVRPVALPCQ GLQDLTFSTV       180
     YLEASRRLVV RDGSGISGPA DLARRRVCTH HDPASMSALS RIAPKATILA VPDWDDCLMA       240
     IQQRQADAVA GAAFLAGLVA QDPNLEIVGP ETDSAQYAIG LAPGNDDLVR FVNGTLERLR       300
     TDGTWAALYE RWLSSLGPAP GPPAPEYRD                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page