(data stored in ACNUC7421 zone)

EMBL: CP000431.PE229

CP000431.PE229       Location/Qualifiers
FT   CDS             complement(275519..275923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00229"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92065"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK71"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92065.1"
FT                   /translation="MELVERAVSAEIDAAARAVITAAAAEASRHADEIIGTGPLPGTAE
FT                   WDAEQGTDIPNQRTLAWHLLSLRIQLAAGLDGIETVLGLRFQGATWATIGKAAGMTRQS
FT                   AHERWGSRTTALLDPMGTGLPKTVADDDPS"
     MELVERAVSA EIDAAARAVI TAAAAEASRH ADEIIGTGPL PGTAEWDAEQ GTDIPNQRTL        60
     AWHLLSLRIQ LAAGLDGIET VLGLRFQGAT WATIGKAAGM TRQSAHERWG SRTTALLDPM       120
     GTGLPKTVAD DDPS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page