(data stored in ACNUC7421 zone)

EMBL: CP000431.PE23

CP000431.PE23        Location/Qualifiers
FT   CDS             complement(29439..30749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00023"
FT                   /product="conserved hypothetical protein"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00023"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91859"
FT                   /db_xref="GOA:Q0SKS7"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS7"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91859.1"
FT                   /translation="MMSDDRHEQLGSGDLITLVSDVGPVPMNVGAILFVAGEGDVDAAT
FT                   VEATFTRRLTSIRRLQQRLATPRRGLGRPYWVDDSDFDVHAHVSRVRCPCPGERDAALA
FT                   IAVDAVTRPLPRSRPLWRAVVVTGLTGGHIGLVLVLHHVVADGIGGLAVLARVVDGADA
FT                   AGPADNTAAPPRGRFVDCVADRTRTLRRLPRTVSRIRDGWAELGRGRLGWAPRCSLNVP
FT                   TGSRRTVTTVDVGLDRVRAAGRRSGATVNDVLLVAVTGALATLLHERKEFPQELVVSVP
FT                   VSARSTTTSGYLGNQVGVMPVRVPLEGSVEERLAAVSRITRARKMRTRGTSSALIGPLF
FT                   RILAAVRLFRRLVDRQRLVNSFLTNLPGPAGQLVIAGAPITDITPITVTAGNVGVAFAA
FT                   LSYAGTLTVTIVVDPDVVPEIRELAAYLREQFRAAIE"
     MMSDDRHEQL GSGDLITLVS DVGPVPMNVG AILFVAGEGD VDAATVEATF TRRLTSIRRL        60
     QQRLATPRRG LGRPYWVDDS DFDVHAHVSR VRCPCPGERD AALAIAVDAV TRPLPRSRPL       120
     WRAVVVTGLT GGHIGLVLVL HHVVADGIGG LAVLARVVDG ADAAGPADNT AAPPRGRFVD       180
     CVADRTRTLR RLPRTVSRIR DGWAELGRGR LGWAPRCSLN VPTGSRRTVT TVDVGLDRVR       240
     AAGRRSGATV NDVLLVAVTG ALATLLHERK EFPQELVVSV PVSARSTTTS GYLGNQVGVM       300
     PVRVPLEGSV EERLAAVSRI TRARKMRTRG TSSALIGPLF RILAAVRLFR RLVDRQRLVN       360
     SFLTNLPGPA GQLVIAGAPI TDITPITVTA GNVGVAFAAL SYAGTLTVTI VVDPDVVPEI       420
     RELAAYLREQ FRAAIE                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page