(data stored in ACNUC7421 zone)

EMBL: CP000431.PE231

CP000431.PE231       Location/Qualifiers
FT   CDS             complement(276965..277291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00231"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92067"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK69"
FT                   /protein_id="ABG92067.1"
FT                   /translation="MVVVEGYSNMRGHAMSSSAPTAARSRRAENWSAAMASNPTDVSNF
FT                   LVSESPSPTLVVESEASCTACPHSADSHDELGIRFCAVTSARSLERKCICAGDQVSGQH
FT                   YSRY"
     MVVVEGYSNM RGHAMSSSAP TAARSRRAEN WSAAMASNPT DVSNFLVSES PSPTLVVESE        60
     ASCTACPHSA DSHDELGIRF CAVTSARSLE RKCICAGDQV SGQHYSRY                    108
//

If you have problems or comments...

PBIL Back to PBIL home page