(data stored in ACNUC7421 zone)

EMBL: CP000431.PE232

CP000431.PE232       Location/Qualifiers
FT   CDS             277548..304163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00232"
FT                   /product="non-ribosomal peptide synthetase"
FT                   /EC_number="5.1.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00232"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92068"
FT                   /db_xref="GOA:Q0SK68"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010060"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK68"
FT                   /protein_id="ABG92068.1"
FT                   /translation="MDTRNRSDATVRSRPDAFPLTPVQRGIWLAQRLAPDVPRCIAQYV
FT                   EVRGALDLAALDDASVTAGREFQSAFLRVFEIDGQPFQIVDPTIELSTGYVDLGDEPDP
FT                   VAAAHAWMTRDYTAPLDPTRDRLATSTVLQIGDDCYLWYSRIHHVALDGYGAMTLVNRI
FT                   AALYTARVEARTPQPAGAADLRTLHRLDEEYRSSRHYESDRAYWRDRLAGLRSNSSLSP
FT                   TVAPAVADSILEKTLLSTAATERLDRSGERLGTPPATGVIAAFATYLARMTGQDDVVVD
FT                   LPVSGRTTTLLQRSGGMLVGLAPLPVATAPDDTVASLTRRVHHEILGALRHQRFTLEDI
FT                   RRETDAAESLCGPMVNVMLFHRRIQFGPLTGDFHVVTSGPVEDLLVNVYRTTAAGRTVI
FT                   EFRGNPHRYSRDELARHHRSFVGLLEEFLAADPGDPVAEVHTESAHEGDRIHRRTAHLD
FT                   YWRTMLTDLAHDTPLPRDHTRRAGTVDGRREHVEAHVTADLHHRIETLGRDCPFATYTV
FT                   THAAVAALLARLGGVRDVVLGTPAGSGGWPLVLRMRVDGTESFTELVERARTTELGAFT
FT                   HADVSFDEIAAALAIPAASAGRHPFQVGFDLQTSDHPHEPDSRSDEGADLWIHIVEHPG
FT                   RAGLDLRLTFARELFEPSTIRGFADRLVRVLDQVTAHPDIPIADLDLLSSAEWRRLVPA
FT                   RGDPGVPPRTLPEILANAAHRDPDAIAVVDAAGDGTGITYRQLDAESTQLARVLLSRGA
FT                   GPETVVALALPRSADLVRAVWAVAKSGAAFLPVDPGYPEARIAHMLTDSGANLGVTVSR
FT                   HRGDLPGDVEWIELHDRNADDTTSVRTSTPVGDADRPRPLRWDHPAYLIYTSGSTGVPK
FT                   GVVVTHRGIANLIAAQIKGLDVPPTGRVAQFASPSFDASLFELLAAVGSGARVVIVPPE
FT                   VVGGTELERVLTDYQVTHAVLTPTTLATLEPRGAPTLSHLTVAGEVCPPEVVSTWAPGP
FT                   RVVNAYGPTEATIMSTISAPLVPDEPVSLGAPACGFEVVVLDDRLHPVPPGTVGELYLA
FT                   GPGLARGYRNRAGLDAVRFVAAPFGSPGTRMYRTGDLVRWRVRHGEDPSAALDLAYVGR
FT                   SDFQVKVRGFRIELGEIEAVLRADPSVGFAVATAATDPNTGDAAVIAYVHPAEGRRVDV
FT                   GEMHRRLARTLPAHMLPAAVVPLDVIPRTPSGKLDRAALPAPTFAPRSGAGHRPRTPTE
FT                   ETVASVFETVLGVTGVGVDDDYVDLGGGSLAATRVVARLNSALETSLDVRDLFEHPTVA
FT                   ALADIVESRRGDGSERPPLRRFPRPARIPLSPAQERMWFVNQYDPHSPAYDIPLVVRLT
FT                   GHLDVGALEAAIADVVERHESLRTVYPTSDDGPHQVILPAERALPRVETVRVDGPTGLD
FT                   AHVAGAAAAPFDVTVDAPLRASLFTIGDTDHVLALVIHHIAADGASAGPLARDLSAAYR
FT                   ARVEGRAPAWEPPAVQYVDYALWQHALLGRPTDPDSLASRQLDYWSESLRGSPPLLALP
FT                   TDRPRPQRRSLHGGRVDFHLPPELHAGMRALSRTCTSTLFMTCHAALAVVLARLAGTYD
FT                   VSIGTPVAGRGEPALDDVVGMFVNTLVLRTRIDPEAGFADTVRTVRDVDLGAFAHADYP
FT                   FEKLVDSLEPERTDSRSPLFQVLLEFQNVLPAGHEARELDLPGLHVAAVGYDPKICKFD
FT                   LQVWLSERRDDGGAPQGIDGRIVYATDLFDEETVRGLADRLVRVLNIVTTEPDTVVGNI
FT                   DLLTDRERDVALRSWTAPDEPGPATTLPAEFARTAARQPDAVAVSFAGDTLSYGELADR
FT                   VNRIARLLHDHGAEPERLVAVAIPHSMDYVAVTLGVLAAGGACLPLDPGWASPTQTSRT
FT                   IPDIAIFVTISAVEEHLPHGHVPTLVLDAPGTVADLARRSGHPLTAVDVGAGPSPDTAA
FT                   YVLLTRGSTALPKPVSVTHRAVLSALARPAVPAGEVWAMVPTFAPGVTVLTPWSAFLHG
FT                   GRLEVVDDATASAPSALADLLHRRGVNMVAQTPAAYEHLSRARESAPAADELRSVLLTG
FT                   DPVDAAVVAAPEVVAVYASVEAVWFAAATDRAPEAGADRMEYRPARGRRFAVLDDRLAP
FT                   VPPGVVGELYIGGPTLARGYHRRAAATSTHFVASPLGPPGERMLRTGDAACLTPTGGLN
FT                   ILWRRDFQSELRGYRIPLGDIDTVLTAHPQVANAVTVDHTPRAGKPALVTYVVPAPGST
FT                   TTISEVRAHAAMILPPPWVPGAVVVLDRLPVTETGDVDLDALPVPEELRHAPVYHAPAT
FT                   PTEKTVSRVIAQVLGIGGVGVDDNFFELGGTSLDAAKVVARIDSAFGTRIGIRSLFEAP
FT                   TVRGLATVLDASEVHPDRPALGPRAHTEPAPVSFAQQRMWFVNQFDVTSAVYNVPMVVR
FT                   LTGLLDVPALHAALIDVLVRHEPLRTLYPLTDTGPVQVVVPAESVPVDLAPIPVADAAR
FT                   VSGLVDEVVAEGFDVTVRPPVRVRLWQLDDHAHVLAVVVHHIVADGSSLAPLARDLSTA
FT                   YTARRVGRAPVWEPLPVRFSDFAVWQREVLGSVTNPASPVARQLDFWRTALADLPERLE
FT                   LPLDRPRPATASYRAAAVPFVMPERTHRRLIDFARAHDTTTFVVIHAALAVLLSRLAST
FT                   TDVVVGSPTAGRGEQTLDPLVGMFVGTLVLRTTVDPASPFGAVVAAVRDADLAAFAHAD
FT                   IPFETLVDELHPPRSAALHPLFQVMLSFQNIEPPCLGLPGLEAHVTDLEPRVSPFDLNV
FT                   VVREQPAEDGSLTGISGQIVYATDLFDAGTIRAFSSRLLRVITAALTNPETVVGDVDIL
FT                   DDAERGLVLDRWNATAHDLPATTIVDLFEAQVAATPDAPAVRGEDRILTYAELDTWSTR
FT                   LAHSFLARGIGTESIVALVIPRSVEMLAAMYAVVKSGAAVLALDPSHPTDRIESLIQSA
FT                   SAALVVTTGDADVPVPTGLPVARFDDIDHEARDTAPVTDVDRGASLHPDNLAYVVYTSG
FT                   STGAPKGVAVSHAAIANQLAWSQAQLPIHEHDRTVQKAPIAFDVAIWECFAALCSGSVL
FT                   VLLPPDRQFDLDYLSGLLDDMQITVVEFVPSLLDVFVNDHRHSFPGSLRRVLTGGEAIS
FT                   ARTASSVLAQGVRLGNMYGPAEAAVTATYHDVAAARAATTVPIGSPVWNTQVYVVDGRL
FT                   HPVVPGVTGEMYLGGAQLARGYLGRPGITAGRFVANPFGAPGSRMYRTGDLARWNPDGQ
FT                   LDYHGRTDFQVQLHGYRVEPGEVESALLRHPGIAQAVVVPRADRNGAHHLVGYVVPVPG
FT                   IDVAEEELLDHTRSLLPSHMVPSAVISLSTLPLTPHGKVDRNALPIVDFTTRAAEFRSA
FT                   GTAVEESLVTLVRDVLGLESVGVDDSFFALGGDSIMAIQLVARAKTAGLALTPRDVFEY
FT                   KTIARLARAISTRPEPRAVLSELPGGGIGSFPLPPAARWLLERGGDLDTFCQSVLLTAP
FT                   PDLNTDTLTATVQTVLDHHDMLRARLRRGTTDEDTVLEVVAAHQAPRVESLIRRVALDD
FT                   PADLKGRAEVESRAAATRLDPENGIMLQLVWLDPHTQPGHLLLTIHHLAIDGVSWRILI
FT                   PDLATAHHAHTTGTTPTLPPVTTSARRYAHALTDTTTHHTHELPHWRTILTTPDPPLGT
FT                   RPLDPTHDTEHTTTHTTTELPPHTTHTLLTTLPTTYHCGIDDALLTALALAVTTWRHRH
FT                   HTPTHTLLVTIEGHGRTNTHIPGADLTHTLGWFTTIHPALLDLTDIDLHDALTGGPATG
FT                   HALTTIKEQLHNTPDHGTGYGPLRYLNPHTATQLRNLPQPQITLNYLGRFDYPPSRPEA
FT                   GWMPVTDVDLSRRPDSDLAAAAVLTIDAATVVTEGAARLTATWSYAAGVLAATDVDDIT
FT                   ELWTEALTALADHISRPGAGRLTPSDLDLVHLDQPALDALHHHYPTLTDVWPLTPLQAG
FT                   LLFHAELGGPAADAYVVQLVLDISGPLDADRLRDAGAALLGRHPNLGAAFTHTADGTPV
FT                   QVVTTTALAWAHHDVTTAHRPAAELGDIVTADRAAPFDPAEPPLLRFTLVTTGPDDHHL
FT                   VLTNHHLVLDGWSTPLLLHELLQLYESHADPDALAPVRPYRDFLEWLGTRDVSASVAAW
FT                   GRALEGVEDATRLAPGLEPHRDPGPCAERVVALTAAETDALRTVARTHDLTLHTIIDTA
FT                   WALVLATHTGTTDITFGTTVSGRPPHIPGIETMIGLFINTIPVRITLHPTDTLTTLLTR
FT                   THTTHTQLLDHHHLPLTHIPNPHATTFDTITVHENYPHHTTTPPTDLTITTTSATDATH
FT                   YPLALAATTDTTLHLRGIFQLSAFDADSVDAILGQLARVLVAMGSDASLPIARLNLLDA
FT                   AEQRAVVPALGEAADEPRTLGAILGDAAERSPDAVAVDDGARRLTYAELEARALLLADR
FT                   LVESGVGPESVVAIAIPRSLESVLAVWAVAGTGAAFVPVDPTYPQIRIQHMVADSGVLV
FT                   GLTTSSRRDALPDTVTWIDIEGTGAGRLPHAGVSEACPAPTIRPDNAAYLIYTSGSTGV
FT                   PKGVVVGHRGVNSLATTLRECTGVTAASRVAHFASPSFDASVLEYLLTWSAGATAVIVP
FT                   TTIYGGDELRRHLADSRVTHAFLTPTTLTALDPDGLDDLECVVTGGEKCTPEVIRRWSP
FT                   HCRLINAYGPTESTVAADISDDPAADGANVIGGPIRGVTEVVLDARMQPVPIRARGELY
FT                   IAGDAIARGYHGKPALTATRFVADPFGPPGGRMYRSGDVVRWNTGREGSAVLEYLGRTD
FT                   SQVKVRGYRIEPGEIDAVLSGHPAVTFSATLPSTGGPDTTDQDATLISYVTTAGAAGPR
FT                   ELRDYLAGRLPAQLVPSAVIEIDVVPRTPSGKLDRDALRALRSTPLPAQVSAANPLEQT
FT                   VAETLAAALDLSSLGVDDDFFAAGGDSLTATRAVARVNTTLHTDLAVRSLFEAPTPRAL
FT                   ARLLLDDTQSEPRPPLTAAAQEPEYAPLSPAQQRIWFLNQYDTTTPTYNIPLTLHLTGH
FT                   LDTTALHHALTDLIHRHQPLHTTYPLHHGHPTQHIHPHPTTPPLTPTPTTETQLPHHIN
FT                   TDTTQPFDLTTDTPLHTHLYQLDNTHHTLTLVLHHIAADGHSLTPLTHDLTTAYTAHTH
FT                   HQPPHPTPLPLTYTDYTHWQHQLLGTPQHPTPTTHTQTTYWTTTLTNLPDTLPLPTDRP
FT                   RPTHRTHHGESIRFEIPADVHHRLRALARSTGATTFMTLHAAFAALLARLCDTDDVVIG
FT                   TPVAGRPDPRLDQLVGMFVGTLVLRTPVDSAGSFREVLTRTRDADLGAFMHADLPFEML
FT                   VDILAPERSTTHTPLFQVLIDYGTEVPLHLELPDLTVTVAEDTPPLAKFDLQLTLREHA
FT                   DAANPGLSAAFTYATDIFDRTTVEGVAARFLRLLDSVTADPGRPVGDVDLLDATERTAL
FT                   TTGSSTPSPPAEPVEAILADRFTRSVRRFADESALTDTGETLTYAALGARVYRLARHLV
FT                   ELGAAPDTVVAVALPPSIDLVVALLAAQQAGAGYLALDVGHPADRLDATMSDAAPVCLV
FT                   STTDHAARLRRNLPTVLADDADTRAHLLDLSPDPITDPERRAALTPDAVAYVVYTSGST
FT                   GRPKGVVVTHRNLTTLFDNTRTAFDFAETDVWTLFHSAAFDFSVWELWGALLHGGRLVI
FT                   VDTVTARAPDEFLSLLRRERVTVLCQTPTAFAQLATAERNQPTDLALRYVVFGGEALEH
FT                   GHLVDWLDRHDHTRPQLVNMYGITETTVHVTRHPLGDPRPAARSVIGRAIPGLRVYVLD
FT                   RRLHPVPTGVTGEMYVAGNQVTRGYLHRSGLTVTRYVADPAGRGGRMYRTGDLARWNAQ
FT                   GQLEFLGRSDAQVQLHGYRIEPGEVEATLVRHPDVAQAAVSVRPDDRGTERLIGYVVPV
FT                   RDGEQTRAVDIDRVLGFARTILAPHMVPATLVVLDRLPLTPNGKLDRRQLPAPDFAERV
FT                   STGRAPVTASELALAEIFAEVLGVPSVSADESFFALGGDSIMAIQLVSRAHEDGVFVTP
FT                   RDIFEHQTVAALAEVAATVKQDVLAELPGGGVGTAPLVPIARWLLERGGDLDTFCQSVL
FT                   LTAPPDLNTDTLTATVQTVLDHHDMLRARLRRGKTDQDTVLEIPPAGTIAAAPLITHVA
FT                   VETHSDNDLAATARAQLDAATHRLDPENGIMLQLVWLDPHTQPGHLLLTIHHLAIDGVS
FT                   WRILIPDLATAHHAHTTGTTPTLPPVTTSARRYAHALTDTTTHHTHELPHWRTILTTPD
FT                   PPLGTRPLDPTHDTEHTTTHTTTELPPHTTHTLLTTLPTTYHCGIDDALLTALALAVTT
FT                   WRHRHHTPTHTLLVTIEGHGRTNTHIPGADLTHTLGWFTTIHPALLDLTDIDLHDALTG
FT                   GPATGHALTTIKEQLHNTPDHGTGYGPLRYLNPHTATQLRNLPQPQITLNYLGRFDYPP
FT                   HGLSNGAGWEPITSIEFDTTILGNVPVAAILDVNAYVYESGGAPILRTTWVYPPGVLPA
FT                   ADVTELTELWTEALTALADHISRPGAGRLTPSDLDLVHLDQPALDALHHHYPTLTDVWP
FT                   LTPLQAGLLFHHELTSQDLDTYVVQLVLDIDGPLDPDRLRDAADALLGRHPNLRAAFGH
FT                   TPDGTPIQIITPAILPWNHHDLSDERDGTVAHDIVTADRTTAFDLTAPPLLRLTLITHG
FT                   PTHHQVALTHHHILLDGWSTPLLLHELLQLYEHHTDPGAVPRPLPYRRYLEWLTQQSLE
FT                   ESRAAWADVLDGLEGPTILVPSARGRVPSTFPEEYRVSLSREHTDALRTVARTHDLTLH
FT                   TIIDTAWALVLATHTGTTDITFGTTVSGRPPHIPGIETMIGLFINTIPVRITLHPTDTL
FT                   TTLLTRTHTTHTQLLDHHHLPLTHIPNPHATTFDTITVHENYPHHTTTPPTDLTITTTS
FT                   ATDATHYPLALAATTDTTLHLKFEFLPEFLSRKDTEAIAAHMCRALDVIATAPDTTVAS
FT                   VRLLGDDEFRALAPVRGGPAPATRTLATIVTDAAALDPDAVALEDSGRAVSYRDLDEAS
FT                   NRLARLLITRGAGPERYVALAIPRSADSVLAVWAITKTGAAFVPIDPGYPAARITDMIA
FT                   DSGVALGVTLTPQRERLPATVPWLVLDEPGTVTMVEQQPSGAVGDADRRRPLRPDHPAY
FT                   MIYTSGSTGVPKGVVVPHRGLATLAAAQAAGLGPGRHSRVLHFSSPSFDGSVFDYLLAF
FT                   GCGATLVISPPTIVGGTELSRFVAAERVTHAFVPTAALASADPDDLDGYDGFGEILAAG
FT                   EACPPGLVTRWSRGRALRNGYGPTETTVMSNISAPLAPGSDVTIGGPIAGAEEVVLDAR
FT                   LQPVPDGVPGELYIAGPGLARGYHRRPGLTAGRFVAAPYGPAGERMYRTGDIVRWIADT
FT                   SGGRVVEYLGRADFQVKVRGFRIEPAEVDAVLGAHPDVEYAATLTRTGPAGDPILVSYV
FT                   VGSAELAPALLSAYLTERLPAHMVPSAIVPIDRIPLTPVGKLDRAELPDPRFDSPADPA
FT                   HRPTSPVEETIANAFAAVLGLEHVGVDDNFFEAGGNSLTATRVVARVNSTLHTHIDVRT
FT                   LFEDRTPRVLSTHLDHDSNDAPLPVPTPGPQPEFVPLSPAQQRIWFLNQYDTTTPTYNI
FT                   PLTLHLTGHLDTTALHHALTDLIHRHQPLHTTYPLHHGHPTQHIHPHPTTPPLTPTPTT
FT                   ETQLPHHINTDTTQPFDLTTDTPLHTHLYQLDNTHHTLTLVLHHIAADGHSLTPLTHDL
FT                   TTAYTAHTHHQPPHPTPLPLTYTDYTHWQHQLLGTPQHPTPTTHTQTTYWTTTLTNLPD
FT                   TLPLPTDRPRPTHRTHHGDRVVFHIGRDLHRSLSALARQNNSTLFMAIHAVFAVLLARL
FT                   SGSSDIVIGTPVAGRPDPRLDPLVGMFVNTLVLRTPVDGSRSFTEVLDRTRDVDLGAFL
FT                   HADLPFERVVEAVDPARSTSRSPLFQVSLEFESVQRPEITLPDLTVTVAEYTPPVVKVD
FT                   LELVVAETFDESGDPNGIAAGFTYATDIFDAATVQGFADRLTRLLAAVVADPDHPVGDL
FT                   TLGDEDEDTSVSGPPGLPARVWPDLLTEAVERHADRLAVSDAGRALTYRQLGEDSAQFA
FT                   RLLIARGAVPEGVVALALPRSIAWVRAVWAVARSGAASVPVDPTYPLTRIAHMLADAGA
FT                   ALGLTVAGYRAQLPDTVEWLVLDDPDFETQTRHFPSTPVTDVDRTAPLRTDNPAYLIYT
FT                   SGSTGAPKGVVVSHRGLANLFEQERHHLHVTPDARVSHLASPSFDASLFELTMAFCAGA
FT                   QVVLVPPPTYGGSALADILAVERITHAFITPTALATLEPTGLDSLRVLVVAGEPCPTDL
FT                   ARRWAPGRRMLDAYGPTETTIWSHVSEPLAPAEPVTIGRPVRGFTAAVLDARLHPVPPG
FT                   TPGELYLAGPGLARGYHDRPATTATHFVACPFAAPGWRMYRTGDLVRTRPDLTLEHLGR
FT                   TDFQIKVRGFRVEPGEVDSILAARADIGFAATVGRTGPDGEPILVTYVHGATGVDVDAS
FT                   AVRTALSAQLPPYLVPAAVVVLDEVPLTPAGKLDRSALPEPEFGPRPDRFRAPSTAVER
FT                   AVVEAIAEVVDIGEDRPIGVEDDFFALGGTSLSAVRVAADLQRRLGRPVPLPALFLDPT
FT                   PAGLAARLATEVPATTDEALRVLVPLRRGDRLAPLFCVHAGMGLAWAYTGMVRHLSPDR
FT                   PVWGLQLPSLGGGPEYDSIEDLAHRYLDEVRAVQPAGPYHLLGWSLGGLIAHAMATELQ
FT                   DRGEEVASLVLLDSYAGEPIAEPDPLDVGDLLRGLGVDVGPGANSRPLRYSDASDRLRE
FT                   AYGPAAAMTADQLRRIAEGYDRSTRLAARFAPRVFRGDALLLIAEDGPHDGWGDSITGT
FT                   VQEEHVDCGHNDMMQPKPARAIGMLVENYLSGRGR"
     MDTRNRSDAT VRSRPDAFPL TPVQRGIWLA QRLAPDVPRC IAQYVEVRGA LDLAALDDAS        60
     VTAGREFQSA FLRVFEIDGQ PFQIVDPTIE LSTGYVDLGD EPDPVAAAHA WMTRDYTAPL       120
     DPTRDRLATS TVLQIGDDCY LWYSRIHHVA LDGYGAMTLV NRIAALYTAR VEARTPQPAG       180
     AADLRTLHRL DEEYRSSRHY ESDRAYWRDR LAGLRSNSSL SPTVAPAVAD SILEKTLLST       240
     AATERLDRSG ERLGTPPATG VIAAFATYLA RMTGQDDVVV DLPVSGRTTT LLQRSGGMLV       300
     GLAPLPVATA PDDTVASLTR RVHHEILGAL RHQRFTLEDI RRETDAAESL CGPMVNVMLF       360
     HRRIQFGPLT GDFHVVTSGP VEDLLVNVYR TTAAGRTVIE FRGNPHRYSR DELARHHRSF       420
     VGLLEEFLAA DPGDPVAEVH TESAHEGDRI HRRTAHLDYW RTMLTDLAHD TPLPRDHTRR       480
     AGTVDGRREH VEAHVTADLH HRIETLGRDC PFATYTVTHA AVAALLARLG GVRDVVLGTP       540
     AGSGGWPLVL RMRVDGTESF TELVERARTT ELGAFTHADV SFDEIAAALA IPAASAGRHP       600
     FQVGFDLQTS DHPHEPDSRS DEGADLWIHI VEHPGRAGLD LRLTFARELF EPSTIRGFAD       660
     RLVRVLDQVT AHPDIPIADL DLLSSAEWRR LVPARGDPGV PPRTLPEILA NAAHRDPDAI       720
     AVVDAAGDGT GITYRQLDAE STQLARVLLS RGAGPETVVA LALPRSADLV RAVWAVAKSG       780
     AAFLPVDPGY PEARIAHMLT DSGANLGVTV SRHRGDLPGD VEWIELHDRN ADDTTSVRTS       840
     TPVGDADRPR PLRWDHPAYL IYTSGSTGVP KGVVVTHRGI ANLIAAQIKG LDVPPTGRVA       900
     QFASPSFDAS LFELLAAVGS GARVVIVPPE VVGGTELERV LTDYQVTHAV LTPTTLATLE       960
     PRGAPTLSHL TVAGEVCPPE VVSTWAPGPR VVNAYGPTEA TIMSTISAPL VPDEPVSLGA      1020
     PACGFEVVVL DDRLHPVPPG TVGELYLAGP GLARGYRNRA GLDAVRFVAA PFGSPGTRMY      1080
     RTGDLVRWRV RHGEDPSAAL DLAYVGRSDF QVKVRGFRIE LGEIEAVLRA DPSVGFAVAT      1140
     AATDPNTGDA AVIAYVHPAE GRRVDVGEMH RRLARTLPAH MLPAAVVPLD VIPRTPSGKL      1200
     DRAALPAPTF APRSGAGHRP RTPTEETVAS VFETVLGVTG VGVDDDYVDL GGGSLAATRV      1260
     VARLNSALET SLDVRDLFEH PTVAALADIV ESRRGDGSER PPLRRFPRPA RIPLSPAQER      1320
     MWFVNQYDPH SPAYDIPLVV RLTGHLDVGA LEAAIADVVE RHESLRTVYP TSDDGPHQVI      1380
     LPAERALPRV ETVRVDGPTG LDAHVAGAAA APFDVTVDAP LRASLFTIGD TDHVLALVIH      1440
     HIAADGASAG PLARDLSAAY RARVEGRAPA WEPPAVQYVD YALWQHALLG RPTDPDSLAS      1500
     RQLDYWSESL RGSPPLLALP TDRPRPQRRS LHGGRVDFHL PPELHAGMRA LSRTCTSTLF      1560
     MTCHAALAVV LARLAGTYDV SIGTPVAGRG EPALDDVVGM FVNTLVLRTR IDPEAGFADT      1620
     VRTVRDVDLG AFAHADYPFE KLVDSLEPER TDSRSPLFQV LLEFQNVLPA GHEARELDLP      1680
     GLHVAAVGYD PKICKFDLQV WLSERRDDGG APQGIDGRIV YATDLFDEET VRGLADRLVR      1740
     VLNIVTTEPD TVVGNIDLLT DRERDVALRS WTAPDEPGPA TTLPAEFART AARQPDAVAV      1800
     SFAGDTLSYG ELADRVNRIA RLLHDHGAEP ERLVAVAIPH SMDYVAVTLG VLAAGGACLP      1860
     LDPGWASPTQ TSRTIPDIAI FVTISAVEEH LPHGHVPTLV LDAPGTVADL ARRSGHPLTA      1920
     VDVGAGPSPD TAAYVLLTRG STALPKPVSV THRAVLSALA RPAVPAGEVW AMVPTFAPGV      1980
     TVLTPWSAFL HGGRLEVVDD ATASAPSALA DLLHRRGVNM VAQTPAAYEH LSRARESAPA      2040
     ADELRSVLLT GDPVDAAVVA APEVVAVYAS VEAVWFAAAT DRAPEAGADR MEYRPARGRR      2100
     FAVLDDRLAP VPPGVVGELY IGGPTLARGY HRRAAATSTH FVASPLGPPG ERMLRTGDAA      2160
     CLTPTGGLNI LWRRDFQSEL RGYRIPLGDI DTVLTAHPQV ANAVTVDHTP RAGKPALVTY      2220
     VVPAPGSTTT ISEVRAHAAM ILPPPWVPGA VVVLDRLPVT ETGDVDLDAL PVPEELRHAP      2280
     VYHAPATPTE KTVSRVIAQV LGIGGVGVDD NFFELGGTSL DAAKVVARID SAFGTRIGIR      2340
     SLFEAPTVRG LATVLDASEV HPDRPALGPR AHTEPAPVSF AQQRMWFVNQ FDVTSAVYNV      2400
     PMVVRLTGLL DVPALHAALI DVLVRHEPLR TLYPLTDTGP VQVVVPAESV PVDLAPIPVA      2460
     DAARVSGLVD EVVAEGFDVT VRPPVRVRLW QLDDHAHVLA VVVHHIVADG SSLAPLARDL      2520
     STAYTARRVG RAPVWEPLPV RFSDFAVWQR EVLGSVTNPA SPVARQLDFW RTALADLPER      2580
     LELPLDRPRP ATASYRAAAV PFVMPERTHR RLIDFARAHD TTTFVVIHAA LAVLLSRLAS      2640
     TTDVVVGSPT AGRGEQTLDP LVGMFVGTLV LRTTVDPASP FGAVVAAVRD ADLAAFAHAD      2700
     IPFETLVDEL HPPRSAALHP LFQVMLSFQN IEPPCLGLPG LEAHVTDLEP RVSPFDLNVV      2760
     VREQPAEDGS LTGISGQIVY ATDLFDAGTI RAFSSRLLRV ITAALTNPET VVGDVDILDD      2820
     AERGLVLDRW NATAHDLPAT TIVDLFEAQV AATPDAPAVR GEDRILTYAE LDTWSTRLAH      2880
     SFLARGIGTE SIVALVIPRS VEMLAAMYAV VKSGAAVLAL DPSHPTDRIE SLIQSASAAL      2940
     VVTTGDADVP VPTGLPVARF DDIDHEARDT APVTDVDRGA SLHPDNLAYV VYTSGSTGAP      3000
     KGVAVSHAAI ANQLAWSQAQ LPIHEHDRTV QKAPIAFDVA IWECFAALCS GSVLVLLPPD      3060
     RQFDLDYLSG LLDDMQITVV EFVPSLLDVF VNDHRHSFPG SLRRVLTGGE AISARTASSV      3120
     LAQGVRLGNM YGPAEAAVTA TYHDVAAARA ATTVPIGSPV WNTQVYVVDG RLHPVVPGVT      3180
     GEMYLGGAQL ARGYLGRPGI TAGRFVANPF GAPGSRMYRT GDLARWNPDG QLDYHGRTDF      3240
     QVQLHGYRVE PGEVESALLR HPGIAQAVVV PRADRNGAHH LVGYVVPVPG IDVAEEELLD      3300
     HTRSLLPSHM VPSAVISLST LPLTPHGKVD RNALPIVDFT TRAAEFRSAG TAVEESLVTL      3360
     VRDVLGLESV GVDDSFFALG GDSIMAIQLV ARAKTAGLAL TPRDVFEYKT IARLARAIST      3420
     RPEPRAVLSE LPGGGIGSFP LPPAARWLLE RGGDLDTFCQ SVLLTAPPDL NTDTLTATVQ      3480
     TVLDHHDMLR ARLRRGTTDE DTVLEVVAAH QAPRVESLIR RVALDDPADL KGRAEVESRA      3540
     AATRLDPENG IMLQLVWLDP HTQPGHLLLT IHHLAIDGVS WRILIPDLAT AHHAHTTGTT      3600
     PTLPPVTTSA RRYAHALTDT TTHHTHELPH WRTILTTPDP PLGTRPLDPT HDTEHTTTHT      3660
     TTELPPHTTH TLLTTLPTTY HCGIDDALLT ALALAVTTWR HRHHTPTHTL LVTIEGHGRT      3720
     NTHIPGADLT HTLGWFTTIH PALLDLTDID LHDALTGGPA TGHALTTIKE QLHNTPDHGT      3780
     GYGPLRYLNP HTATQLRNLP QPQITLNYLG RFDYPPSRPE AGWMPVTDVD LSRRPDSDLA      3840
     AAAVLTIDAA TVVTEGAARL TATWSYAAGV LAATDVDDIT ELWTEALTAL ADHISRPGAG      3900
     RLTPSDLDLV HLDQPALDAL HHHYPTLTDV WPLTPLQAGL LFHAELGGPA ADAYVVQLVL      3960
     DISGPLDADR LRDAGAALLG RHPNLGAAFT HTADGTPVQV VTTTALAWAH HDVTTAHRPA      4020
     AELGDIVTAD RAAPFDPAEP PLLRFTLVTT GPDDHHLVLT NHHLVLDGWS TPLLLHELLQ      4080
     LYESHADPDA LAPVRPYRDF LEWLGTRDVS ASVAAWGRAL EGVEDATRLA PGLEPHRDPG      4140
     PCAERVVALT AAETDALRTV ARTHDLTLHT IIDTAWALVL ATHTGTTDIT FGTTVSGRPP      4200
     HIPGIETMIG LFINTIPVRI TLHPTDTLTT LLTRTHTTHT QLLDHHHLPL THIPNPHATT      4260
     FDTITVHENY PHHTTTPPTD LTITTTSATD ATHYPLALAA TTDTTLHLRG IFQLSAFDAD      4320
     SVDAILGQLA RVLVAMGSDA SLPIARLNLL DAAEQRAVVP ALGEAADEPR TLGAILGDAA      4380
     ERSPDAVAVD DGARRLTYAE LEARALLLAD RLVESGVGPE SVVAIAIPRS LESVLAVWAV      4440
     AGTGAAFVPV DPTYPQIRIQ HMVADSGVLV GLTTSSRRDA LPDTVTWIDI EGTGAGRLPH      4500
     AGVSEACPAP TIRPDNAAYL IYTSGSTGVP KGVVVGHRGV NSLATTLREC TGVTAASRVA      4560
     HFASPSFDAS VLEYLLTWSA GATAVIVPTT IYGGDELRRH LADSRVTHAF LTPTTLTALD      4620
     PDGLDDLECV VTGGEKCTPE VIRRWSPHCR LINAYGPTES TVAADISDDP AADGANVIGG      4680
     PIRGVTEVVL DARMQPVPIR ARGELYIAGD AIARGYHGKP ALTATRFVAD PFGPPGGRMY      4740
     RSGDVVRWNT GREGSAVLEY LGRTDSQVKV RGYRIEPGEI DAVLSGHPAV TFSATLPSTG      4800
     GPDTTDQDAT LISYVTTAGA AGPRELRDYL AGRLPAQLVP SAVIEIDVVP RTPSGKLDRD      4860
     ALRALRSTPL PAQVSAANPL EQTVAETLAA ALDLSSLGVD DDFFAAGGDS LTATRAVARV      4920
     NTTLHTDLAV RSLFEAPTPR ALARLLLDDT QSEPRPPLTA AAQEPEYAPL SPAQQRIWFL      4980
     NQYDTTTPTY NIPLTLHLTG HLDTTALHHA LTDLIHRHQP LHTTYPLHHG HPTQHIHPHP      5040
     TTPPLTPTPT TETQLPHHIN TDTTQPFDLT TDTPLHTHLY QLDNTHHTLT LVLHHIAADG      5100
     HSLTPLTHDL TTAYTAHTHH QPPHPTPLPL TYTDYTHWQH QLLGTPQHPT PTTHTQTTYW      5160
     TTTLTNLPDT LPLPTDRPRP THRTHHGESI RFEIPADVHH RLRALARSTG ATTFMTLHAA      5220
     FAALLARLCD TDDVVIGTPV AGRPDPRLDQ LVGMFVGTLV LRTPVDSAGS FREVLTRTRD      5280
     ADLGAFMHAD LPFEMLVDIL APERSTTHTP LFQVLIDYGT EVPLHLELPD LTVTVAEDTP      5340
     PLAKFDLQLT LREHADAANP GLSAAFTYAT DIFDRTTVEG VAARFLRLLD SVTADPGRPV      5400
     GDVDLLDATE RTALTTGSST PSPPAEPVEA ILADRFTRSV RRFADESALT DTGETLTYAA      5460
     LGARVYRLAR HLVELGAAPD TVVAVALPPS IDLVVALLAA QQAGAGYLAL DVGHPADRLD      5520
     ATMSDAAPVC LVSTTDHAAR LRRNLPTVLA DDADTRAHLL DLSPDPITDP ERRAALTPDA      5580
     VAYVVYTSGS TGRPKGVVVT HRNLTTLFDN TRTAFDFAET DVWTLFHSAA FDFSVWELWG      5640
     ALLHGGRLVI VDTVTARAPD EFLSLLRRER VTVLCQTPTA FAQLATAERN QPTDLALRYV      5700
     VFGGEALEHG HLVDWLDRHD HTRPQLVNMY GITETTVHVT RHPLGDPRPA ARSVIGRAIP      5760
     GLRVYVLDRR LHPVPTGVTG EMYVAGNQVT RGYLHRSGLT VTRYVADPAG RGGRMYRTGD      5820
     LARWNAQGQL EFLGRSDAQV QLHGYRIEPG EVEATLVRHP DVAQAAVSVR PDDRGTERLI      5880
     GYVVPVRDGE QTRAVDIDRV LGFARTILAP HMVPATLVVL DRLPLTPNGK LDRRQLPAPD      5940
     FAERVSTGRA PVTASELALA EIFAEVLGVP SVSADESFFA LGGDSIMAIQ LVSRAHEDGV      6000
     FVTPRDIFEH QTVAALAEVA ATVKQDVLAE LPGGGVGTAP LVPIARWLLE RGGDLDTFCQ      6060
     SVLLTAPPDL NTDTLTATVQ TVLDHHDMLR ARLRRGKTDQ DTVLEIPPAG TIAAAPLITH      6120
     VAVETHSDND LAATARAQLD AATHRLDPEN GIMLQLVWLD PHTQPGHLLL TIHHLAIDGV      6180
     SWRILIPDLA TAHHAHTTGT TPTLPPVTTS ARRYAHALTD TTTHHTHELP HWRTILTTPD      6240
     PPLGTRPLDP THDTEHTTTH TTTELPPHTT HTLLTTLPTT YHCGIDDALL TALALAVTTW      6300
     RHRHHTPTHT LLVTIEGHGR TNTHIPGADL THTLGWFTTI HPALLDLTDI DLHDALTGGP      6360
     ATGHALTTIK EQLHNTPDHG TGYGPLRYLN PHTATQLRNL PQPQITLNYL GRFDYPPHGL      6420
     SNGAGWEPIT SIEFDTTILG NVPVAAILDV NAYVYESGGA PILRTTWVYP PGVLPAADVT      6480
     ELTELWTEAL TALADHISRP GAGRLTPSDL DLVHLDQPAL DALHHHYPTL TDVWPLTPLQ      6540
     AGLLFHHELT SQDLDTYVVQ LVLDIDGPLD PDRLRDAADA LLGRHPNLRA AFGHTPDGTP      6600
     IQIITPAILP WNHHDLSDER DGTVAHDIVT ADRTTAFDLT APPLLRLTLI THGPTHHQVA      6660
     LTHHHILLDG WSTPLLLHEL LQLYEHHTDP GAVPRPLPYR RYLEWLTQQS LEESRAAWAD      6720
     VLDGLEGPTI LVPSARGRVP STFPEEYRVS LSREHTDALR TVARTHDLTL HTIIDTAWAL      6780
     VLATHTGTTD ITFGTTVSGR PPHIPGIETM IGLFINTIPV RITLHPTDTL TTLLTRTHTT      6840
     HTQLLDHHHL PLTHIPNPHA TTFDTITVHE NYPHHTTTPP TDLTITTTSA TDATHYPLAL      6900
     AATTDTTLHL KFEFLPEFLS RKDTEAIAAH MCRALDVIAT APDTTVASVR LLGDDEFRAL      6960
     APVRGGPAPA TRTLATIVTD AAALDPDAVA LEDSGRAVSY RDLDEASNRL ARLLITRGAG      7020
     PERYVALAIP RSADSVLAVW AITKTGAAFV PIDPGYPAAR ITDMIADSGV ALGVTLTPQR      7080
     ERLPATVPWL VLDEPGTVTM VEQQPSGAVG DADRRRPLRP DHPAYMIYTS GSTGVPKGVV      7140
     VPHRGLATLA AAQAAGLGPG RHSRVLHFSS PSFDGSVFDY LLAFGCGATL VISPPTIVGG      7200
     TELSRFVAAE RVTHAFVPTA ALASADPDDL DGYDGFGEIL AAGEACPPGL VTRWSRGRAL      7260
     RNGYGPTETT VMSNISAPLA PGSDVTIGGP IAGAEEVVLD ARLQPVPDGV PGELYIAGPG      7320
     LARGYHRRPG LTAGRFVAAP YGPAGERMYR TGDIVRWIAD TSGGRVVEYL GRADFQVKVR      7380
     GFRIEPAEVD AVLGAHPDVE YAATLTRTGP AGDPILVSYV VGSAELAPAL LSAYLTERLP      7440
     AHMVPSAIVP IDRIPLTPVG KLDRAELPDP RFDSPADPAH RPTSPVEETI ANAFAAVLGL      7500
     EHVGVDDNFF EAGGNSLTAT RVVARVNSTL HTHIDVRTLF EDRTPRVLST HLDHDSNDAP      7560
     LPVPTPGPQP EFVPLSPAQQ RIWFLNQYDT TTPTYNIPLT LHLTGHLDTT ALHHALTDLI      7620
     HRHQPLHTTY PLHHGHPTQH IHPHPTTPPL TPTPTTETQL PHHINTDTTQ PFDLTTDTPL      7680
     HTHLYQLDNT HHTLTLVLHH IAADGHSLTP LTHDLTTAYT AHTHHQPPHP TPLPLTYTDY      7740
     THWQHQLLGT PQHPTPTTHT QTTYWTTTLT NLPDTLPLPT DRPRPTHRTH HGDRVVFHIG      7800
     RDLHRSLSAL ARQNNSTLFM AIHAVFAVLL ARLSGSSDIV IGTPVAGRPD PRLDPLVGMF      7860
     VNTLVLRTPV DGSRSFTEVL DRTRDVDLGA FLHADLPFER VVEAVDPARS TSRSPLFQVS      7920
     LEFESVQRPE ITLPDLTVTV AEYTPPVVKV DLELVVAETF DESGDPNGIA AGFTYATDIF      7980
     DAATVQGFAD RLTRLLAAVV ADPDHPVGDL TLGDEDEDTS VSGPPGLPAR VWPDLLTEAV      8040
     ERHADRLAVS DAGRALTYRQ LGEDSAQFAR LLIARGAVPE GVVALALPRS IAWVRAVWAV      8100
     ARSGAASVPV DPTYPLTRIA HMLADAGAAL GLTVAGYRAQ LPDTVEWLVL DDPDFETQTR      8160
     HFPSTPVTDV DRTAPLRTDN PAYLIYTSGS TGAPKGVVVS HRGLANLFEQ ERHHLHVTPD      8220
     ARVSHLASPS FDASLFELTM AFCAGAQVVL VPPPTYGGSA LADILAVERI THAFITPTAL      8280
     ATLEPTGLDS LRVLVVAGEP CPTDLARRWA PGRRMLDAYG PTETTIWSHV SEPLAPAEPV      8340
     TIGRPVRGFT AAVLDARLHP VPPGTPGELY LAGPGLARGY HDRPATTATH FVACPFAAPG      8400
     WRMYRTGDLV RTRPDLTLEH LGRTDFQIKV RGFRVEPGEV DSILAARADI GFAATVGRTG      8460
     PDGEPILVTY VHGATGVDVD ASAVRTALSA QLPPYLVPAA VVVLDEVPLT PAGKLDRSAL      8520
     PEPEFGPRPD RFRAPSTAVE RAVVEAIAEV VDIGEDRPIG VEDDFFALGG TSLSAVRVAA      8580
     DLQRRLGRPV PLPALFLDPT PAGLAARLAT EVPATTDEAL RVLVPLRRGD RLAPLFCVHA      8640
     GMGLAWAYTG MVRHLSPDRP VWGLQLPSLG GGPEYDSIED LAHRYLDEVR AVQPAGPYHL      8700
     LGWSLGGLIA HAMATELQDR GEEVASLVLL DSYAGEPIAE PDPLDVGDLL RGLGVDVGPG      8760
     ANSRPLRYSD ASDRLREAYG PAAAMTADQL RRIAEGYDRS TRLAARFAPR VFRGDALLLI      8820
     AEDGPHDGWG DSITGTVQEE HVDCGHNDMM QPKPARAIGM LVENYLSGRG R               8871
//

If you have problems or comments...

PBIL Back to PBIL home page