(data stored in ACNUC7421 zone)

EMBL: CP000431.PE233

CP000431.PE233       Location/Qualifiers
FT   CDS             complement(304139..306706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00233"
FT                   /product="probable non-ribosomal peptide synthetase"
FT                   /note="GO_function: GO:0005554 - molecular function
FT                   unknown; GO_function: GO:0016742 - hydroxymethyl-, formyl-
FT                   and related transferase activity; GO_function: GO:0016788 -
FT                   hydrolase activity, acting on ester bonds; GO_function:
FT                   GO:0016874 - ligase activity; GO_function: GO:0031177 -
FT                   phosphopantetheine binding; GO_function: GO:0048037 -
FT                   cofactor binding; GO_process: GO:0009058 - biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00233"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92069"
FT                   /db_xref="GOA:Q0SK67"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK67"
FT                   /protein_id="ABG92069.1"
FT                   /translation="MQYLDQVADLVVVADRRDLDTASLTLVCDVLVGVRDADTVTANPV
FT                   GRHRHGRALGGWSAEVLRSSHPLVAAREDMTATVAAAAAVVTGRRDDLSVVTVPVWRVD
FT                   RTRPPRMLGGFENWVDLAFHTSLDRTLAELAEEVKCSRQQEVSWESVKIGEMRSTATGV
FT                   LGTVTRDTGREYLPCQTAPFPLTLVPVADTGGHATLEVYADPVSVDADTAARFGQWVAR
FT                   VVNGLRDPSPRRRRVFGAAVAPVGAGVRAPVSGGRIEDLVVRQAHERPDAVAVTHGRRT
FT                   LTYRALEEQSAWMARGLHDRGVGPGDRVGICVDRSVDLVVTMLAVLRSGAAFVPMDVRH
FT                   PPDRLAYTARDAGVRLVVTELQGEARWAGVPAVTPAELPGSVSGPGEVDWAVGGDGAPA
FT                   YVVYTSGSTGRPKGVVIPHRAVPALMSATATEFAPTPGDTWSMFHSPAFDFSVWEIWGS
FT                   LSTGGRLVIVPYWISRSPVEFHTLLADERVSVLSQTPSAFVLLAAADRDLEPLSALRLV
FT                   VFGGETLDPRVVLPWLDRYPESRCRLVNMFGTTETTVHVTAHTVTRRDALTGSRTVGKP
FT                   LPGWEMAVADEFGDPLPNGLTGEIYVGGAGVALGYLDRAGLTACRFVAAPGGSRWYRTG
FT                   DRGRICDDGTLEHLGRLDTQVQIRGFRVELDEVRSVLLDDPVVTAAAVVPSGRPEDPAG
FT                   IALDAYVVPGGSAAAGGTETVAAIRERAARFLPEHMVPRSITLVDALPLTINGKIDVAR
FT                   LPAPAPRSLPHNVVEPQDGGPLTDAGTAHMLTDIWESVLGVPVSLDDNLFELGGNSLCA
FT                   IKADSMMRRLGLPALPMRELYRHPSIRGICGTLARLYLPRPDR"
     MQYLDQVADL VVVADRRDLD TASLTLVCDV LVGVRDADTV TANPVGRHRH GRALGGWSAE        60
     VLRSSHPLVA AREDMTATVA AAAAVVTGRR DDLSVVTVPV WRVDRTRPPR MLGGFENWVD       120
     LAFHTSLDRT LAELAEEVKC SRQQEVSWES VKIGEMRSTA TGVLGTVTRD TGREYLPCQT       180
     APFPLTLVPV ADTGGHATLE VYADPVSVDA DTAARFGQWV ARVVNGLRDP SPRRRRVFGA       240
     AVAPVGAGVR APVSGGRIED LVVRQAHERP DAVAVTHGRR TLTYRALEEQ SAWMARGLHD       300
     RGVGPGDRVG ICVDRSVDLV VTMLAVLRSG AAFVPMDVRH PPDRLAYTAR DAGVRLVVTE       360
     LQGEARWAGV PAVTPAELPG SVSGPGEVDW AVGGDGAPAY VVYTSGSTGR PKGVVIPHRA       420
     VPALMSATAT EFAPTPGDTW SMFHSPAFDF SVWEIWGSLS TGGRLVIVPY WISRSPVEFH       480
     TLLADERVSV LSQTPSAFVL LAAADRDLEP LSALRLVVFG GETLDPRVVL PWLDRYPESR       540
     CRLVNMFGTT ETTVHVTAHT VTRRDALTGS RTVGKPLPGW EMAVADEFGD PLPNGLTGEI       600
     YVGGAGVALG YLDRAGLTAC RFVAAPGGSR WYRTGDRGRI CDDGTLEHLG RLDTQVQIRG       660
     FRVELDEVRS VLLDDPVVTA AAVVPSGRPE DPAGIALDAY VVPGGSAAAG GTETVAAIRE       720
     RAARFLPEHM VPRSITLVDA LPLTINGKID VARLPAPAPR SLPHNVVEPQ DGGPLTDAGT       780
     AHMLTDIWES VLGVPVSLDD NLFELGGNSL CAIKADSMMR RLGLPALPMR ELYRHPSIRG       840
     ICGTLARLYL PRPDR                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page