(data stored in ACNUC7421 zone)

EMBL: CP000431.PE236

CP000431.PE236       Location/Qualifiers
FT   CDS             308758..309312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00236"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92072"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK64"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92072.1"
FT                   /translation="MHGTHTDSDMCWVSRPTELDVVGKLVHCLLHHPADCRHTWLRVDP
FT                   QQRNCRRAQRRGRSHGPRSDCEAAELIRVHVVPPTIECMGVAAAARALGRLQYRIARIP
FT                   FHLVDDTVMPAFFDDAAPARLAYEWVLIECDEAAAILFDDDFAATHAQMLRQRSAAVRY
FT                   AIARRQRQALRDTDVVVLERP"
     MHGTHTDSDM CWVSRPTELD VVGKLVHCLL HHPADCRHTW LRVDPQQRNC RRAQRRGRSH        60
     GPRSDCEAAE LIRVHVVPPT IECMGVAAAA RALGRLQYRI ARIPFHLVDD TVMPAFFDDA       120
     APARLAYEWV LIECDEAAAI LFDDDFAATH AQMLRQRSAA VRYAIARRQR QALRDTDVVV       180
     LERP                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page