(data stored in ACNUC7421 zone)

EMBL: CP000431.PE238

CP000431.PE238       Location/Qualifiers
FT   CDS             310530..311678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00238"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92074"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK62"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92074.1"
FT                   /translation="MSRHDGFCASAGPAGLRGAALHRQELRRSGAASAKPGMELCCSSS
FT                   AFEIEAVTGLFHCYVLGGTSLRVGNRSARRPSRNRTLPPRTGGSDNREREFSTFRRRVG
FT                   SRSGPRCAGRSCSPTRADRRTYHGPIGNAPRHLPFRRAALSFMRWQIGRGVLAPLSAMP
FT                   PGSPWWRAVNERLMRDGCEAVARSGGMGGTPSSHTVDLWMLFVADPTARTWYRAHNASI
FT                   ASAYLDHRDLACTESHPERFFLNVVLLRVLYAHALVSAPRLALGRLAPAGPLLGDPRLS
FT                   MTGIFLSLSRVLPDRYPLGDDVAAYVAAEHNIGEMLDYGMIGPRLQQLYEWSADELDEP
FT                   GLLDCICDGSPTYAWSYSDREVWHPASPAATIRAVRRILPAN"
     MSRHDGFCAS AGPAGLRGAA LHRQELRRSG AASAKPGMEL CCSSSAFEIE AVTGLFHCYV        60
     LGGTSLRVGN RSARRPSRNR TLPPRTGGSD NREREFSTFR RRVGSRSGPR CAGRSCSPTR       120
     ADRRTYHGPI GNAPRHLPFR RAALSFMRWQ IGRGVLAPLS AMPPGSPWWR AVNERLMRDG       180
     CEAVARSGGM GGTPSSHTVD LWMLFVADPT ARTWYRAHNA SIASAYLDHR DLACTESHPE       240
     RFFLNVVLLR VLYAHALVSA PRLALGRLAP AGPLLGDPRL SMTGIFLSLS RVLPDRYPLG       300
     DDVAAYVAAE HNIGEMLDYG MIGPRLQQLY EWSADELDEP GLLDCICDGS PTYAWSYSDR       360
     EVWHPASPAA TIRAVRRILP AN                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page