(data stored in ACNUC7421 zone)

EMBL: CP000431.PE24

CP000431.PE24        Location/Qualifiers
FT   CDS             complement(30746..32179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00024"
FT                   /db_xref="EnsemblGenomes-Tr:ABG91860"
FT                   /db_xref="GOA:Q0SKS6"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SKS6"
FT                   /experiment="microarray"
FT                   /protein_id="ABG91860.1"
FT                   /translation="MDDNLSFLDAGFLETEDSDPHASLTIGALAIMEGPVPGQDEFRDT
FT                   VAARFATLPHTRDRVHTVPLDFSAPSWSPDPHFDLGHHLRRVALPEPGEEEALFGFVAR
FT                   VMAHRLDRDRPLWECWVVESLTGDRWAILTKIHHCMADGITGTKLFEAMCDEVVAEASG
FT                   TTEADTDTDAVPARTAGTRLASVEGLIRSTIEFLSPMRQLRLVSAALAVPRRLTAAGIG
FT                   VATGLTHLLSEMLTSSTDTSLIGPIGRQRRYCAARVRMHDVREICATYRVTVNDVALAA
FT                   ITTGLRQLLLKRGEHPDPHTVRTLVPVSVRSATEEHSIHNQVSLMLPFLPVDIDDPVAQ
FT                   LVAVHDRLTTHKASKEAEGGKAFTAVAQYGPFMPMAWAVRLATRFPQHSVVAVATNVPG
FT                   PKATRHVMGRTILEIFPYVPIALRLRIGIAILSYSDHLAFGLTGDYDTTPDLADLTDAI
FT                   ERGVLTLLAASRAAAAASE"
     MDDNLSFLDA GFLETEDSDP HASLTIGALA IMEGPVPGQD EFRDTVAARF ATLPHTRDRV        60
     HTVPLDFSAP SWSPDPHFDL GHHLRRVALP EPGEEEALFG FVARVMAHRL DRDRPLWECW       120
     VVESLTGDRW AILTKIHHCM ADGITGTKLF EAMCDEVVAE ASGTTEADTD TDAVPARTAG       180
     TRLASVEGLI RSTIEFLSPM RQLRLVSAAL AVPRRLTAAG IGVATGLTHL LSEMLTSSTD       240
     TSLIGPIGRQ RRYCAARVRM HDVREICATY RVTVNDVALA AITTGLRQLL LKRGEHPDPH       300
     TVRTLVPVSV RSATEEHSIH NQVSLMLPFL PVDIDDPVAQ LVAVHDRLTT HKASKEAEGG       360
     KAFTAVAQYG PFMPMAWAVR LATRFPQHSV VAVATNVPGP KATRHVMGRT ILEIFPYVPI       420
     ALRLRIGIAI LSYSDHLAFG LTGDYDTTPD LADLTDAIER GVLTLLAASR AAAAASE          477
//

If you have problems or comments...

PBIL Back to PBIL home page