(data stored in ACNUC7421 zone)

EMBL: CP000431.PE241

CP000431.PE241       Location/Qualifiers
FT   CDS             313256..314179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00241"
FT                   /product="transcriptional regulator, AraC family protein"
FT                   /note="GO_component: GO:0005622 - intracellular;
FT                   GO_function: GO:0003700 - transcription factor activity;
FT                   GO_function: GO:0016563 - transcriptional activator
FT                   activity; GO_process: GO:0006355 - regulation of
FT                   transcription, DNA-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00241"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92077"
FT                   /db_xref="GOA:Q0SK59"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK59"
FT                   /protein_id="ABG92077.1"
FT                   /translation="MRNSPDLLDEIRAGITVHARPDLQTPIDGLLLSKVTAESAAPEYS
FT                   LTEPLLVIMTQGGKRLLLGDRLYEYRAGQCLVVTASVPVTGHYIDISEGAPSLAMGLVL
FT                   RPAAIAALVLQAPTERWSRGAAGVPAIETGDADVHLLDAAARMLRLLDHPADAPVLAPL
FT                   IEQEILWRLLTGPHGSTIRQIGMADSDLAHVSRAIHWIRDNYSEPMRIDDLARLSSMSA
FT                   SAFHRHFRAVTAMSPLQYQKRIRLQHARSMLVAHPGDVAGVGHHVGYDSPSQFNREYRR
FT                   LFGASPGKDAHGLRGNTALSDTGPLP"
     MRNSPDLLDE IRAGITVHAR PDLQTPIDGL LLSKVTAESA APEYSLTEPL LVIMTQGGKR        60
     LLLGDRLYEY RAGQCLVVTA SVPVTGHYID ISEGAPSLAM GLVLRPAAIA ALVLQAPTER       120
     WSRGAAGVPA IETGDADVHL LDAAARMLRL LDHPADAPVL APLIEQEILW RLLTGPHGST       180
     IRQIGMADSD LAHVSRAIHW IRDNYSEPMR IDDLARLSSM SASAFHRHFR AVTAMSPLQY       240
     QKRIRLQHAR SMLVAHPGDV AGVGHHVGYD SPSQFNREYR RLFGASPGKD AHGLRGNTAL       300
     SDTGPLP                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page