(data stored in ACNUC7421 zone)

EMBL: CP000431.PE242

CP000431.PE242       Location/Qualifiers
FT   CDS             314326..315222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00242"
FT                   /product="possible 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /note="GO_function: GO:0004022 - alcohol dehydrogenase
FT                   activity; GO_process: GO:0008152 - metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00242"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92078"
FT                   /db_xref="GOA:Q0SK58"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK58"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92078.1"
FT                   /translation="MADQYAQQDPTTQYPAPDREHQPELSHPGLTSDMVTAPDHGEKSY
FT                   RGSGRLDGRRALITGADSGIGRAVAIAFAREGADVVVSCLDEEEADARETVRLVEEAGR
FT                   RGVVATGDITSEDHCQYLVDLTVRELGGLDILVNNAAFQMVQTGGIADITTEQFDRVLR
FT                   TNLYALFWLCKKSVAVMEPGSTIVNTSSIQGTNPSPGLLDYATTKAGIIDFTKGLAADV
FT                   AKRGIRVNAVAPGPIWTPLIPATMPADGYRQFGDDVPLGRPGQPAELAPAYVFLASNES
FT                   SYVTGEVLGVTGGTPFT"
     MADQYAQQDP TTQYPAPDRE HQPELSHPGL TSDMVTAPDH GEKSYRGSGR LDGRRALITG        60
     ADSGIGRAVA IAFAREGADV VVSCLDEEEA DARETVRLVE EAGRRGVVAT GDITSEDHCQ       120
     YLVDLTVREL GGLDILVNNA AFQMVQTGGI ADITTEQFDR VLRTNLYALF WLCKKSVAVM       180
     EPGSTIVNTS SIQGTNPSPG LLDYATTKAG IIDFTKGLAA DVAKRGIRVN AVAPGPIWTP       240
     LIPATMPADG YRQFGDDVPL GRPGQPAELA PAYVFLASNE SSYVTGEVLG VTGGTPFT         298
//

If you have problems or comments...

PBIL Back to PBIL home page