(data stored in ACNUC7421 zone)

EMBL: CP000431.PE243

CP000431.PE243       Location/Qualifiers
FT   CDS             complement(315253..315996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00243"
FT                   /product="probable ATP-dependent Clp protease ATP-binding
FT                   subunit"
FT                   /note="GO_function: GO:0003677 - DNA binding; GO_function:
FT                   GO:0004518 - nuclease activity; GO_function: GO:0005515 -
FT                   protein binding; GO_function: GO:0005524 - ATP binding;
FT                   GO_function: GO:0008233 - peptidase activity; GO_function:
FT                   GO:0017111 - nucleoside-triphosphatase activity;
FT                   GO_process: GO:0006289 - nucleotide-excision repair;
FT                   GO_process: GO:0006457 - protein folding; GO_process:
FT                   GO:0006986 - response to unfolded protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00243"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92079"
FT                   /db_xref="GOA:Q0SK57"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK57"
FT                   /protein_id="ABG92079.1"
FT                   /translation="MENSDRTTPPIRLDELIDAIKKVHAEAPLEQLTDAVLAAEHLGEL
FT                   ADHLIGHFVDQARRSGASWTEIGKSMGVTKQAAQKRFVPKDPGQASDLDPNQGFSRFTP
FT                   RARQVVVVAQNEARAAHNAEILPQHLVLGLLADPEGLGARAIAAQGVKLDSVRHAATAT
FT                   LPPAAEEVPALVPFDAQSRKALELTFREALRLGHNYIGTEHILLALLEVEDGVGVLTGL
FT                   GVDKAAAEENIAANLDAIVAAREKE"
     MENSDRTTPP IRLDELIDAI KKVHAEAPLE QLTDAVLAAE HLGELADHLI GHFVDQARRS        60
     GASWTEIGKS MGVTKQAAQK RFVPKDPGQA SDLDPNQGFS RFTPRARQVV VVAQNEARAA       120
     HNAEILPQHL VLGLLADPEG LGARAIAAQG VKLDSVRHAA TATLPPAAEE VPALVPFDAQ       180
     SRKALELTFR EALRLGHNYI GTEHILLALL EVEDGVGVLT GLGVDKAAAE ENIAANLDAI       240
     VAAREKE                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page