(data stored in ACNUC7421 zone)

EMBL: CP000431.PE244

CP000431.PE244       Location/Qualifiers
FT   CDS             316127..316489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00244"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92080"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK56"
FT                   /experiment="microarray"
FT                   /protein_id="ABG92080.1"
FT                   /translation="MHIEKDLVAASATPLVLGILAEGESYGYAILKRVNDLSGGRIQWT
FT                   DGMLYPLLHRLERLGYVSASWGASDSGRRRKHYTITAAGREMLAERRAQWDVVADALSQ
FT                   VWRSVQLPPASAQGWS"
     MHIEKDLVAA SATPLVLGIL AEGESYGYAI LKRVNDLSGG RIQWTDGMLY PLLHRLERLG        60
     YVSASWGASD SGRRRKHYTI TAAGREMLAE RRAQWDVVAD ALSQVWRSVQ LPPASAQGWS       120
//

If you have problems or comments...

PBIL Back to PBIL home page