(data stored in ACNUC7421 zone)

EMBL: CP000431.PE245

CP000431.PE245       Location/Qualifiers
FT   CDS             316489..317835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00245"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00245"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92081"
FT                   /db_xref="GOA:Q0SK55"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK55"
FT                   /protein_id="ABG92081.1"
FT                   /translation="MDTDKELESQIGQWRGYVERRHAISAADTDEMEDHLRDQISDLSS
FT                   AGLRTDEAFLVAVKRMGNVDDISREFAREHSDRLWKQLVLMPAASDGDGTRATRELFVV
FT                   LGLAVGAALSVKAGVATLGEQDLARNLSLFVLPFLAGYFAWKRQVTPRLAAVLLVPFAL
FT                   AAVLLNVFPFASNGSTEVIAAIHAPIALWFAVGLAYVGGQWRSDRRRMDFIRFTGEWVV
FT                   YLTLLALGGGVLIGLTIGAFDALGLSVEWFIEDWVLPFGAAGAVIVAAWLVEAKQNVVE
FT                   NIAPVLTRVFTPLTTLMLLVLLTAFATTGSVVDVDRNLLILMDLILVVVLGLLLYAISA
FT                   RDPYLPPDLFDRLQLVLVVSALAVDLLMLFAMLTRIAEFGFTPNKVAALGMNLVLLVNL
FT                   TWSAHLILGFLRGHRGFSSTERWQTGYLPVFGMWAALMVGVLPPVFDFV"
     MDTDKELESQ IGQWRGYVER RHAISAADTD EMEDHLRDQI SDLSSAGLRT DEAFLVAVKR        60
     MGNVDDISRE FAREHSDRLW KQLVLMPAAS DGDGTRATRE LFVVLGLAVG AALSVKAGVA       120
     TLGEQDLARN LSLFVLPFLA GYFAWKRQVT PRLAAVLLVP FALAAVLLNV FPFASNGSTE       180
     VIAAIHAPIA LWFAVGLAYV GGQWRSDRRR MDFIRFTGEW VVYLTLLALG GGVLIGLTIG       240
     AFDALGLSVE WFIEDWVLPF GAAGAVIVAA WLVEAKQNVV ENIAPVLTRV FTPLTTLMLL       300
     VLLTAFATTG SVVDVDRNLL ILMDLILVVV LGLLLYAISA RDPYLPPDLF DRLQLVLVVS       360
     ALAVDLLMLF AMLTRIAEFG FTPNKVAALG MNLVLLVNLT WSAHLILGFL RGHRGFSSTE       420
     RWQTGYLPVF GMWAALMVGV LPPVFDFV                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page