(data stored in ACNUC7421 zone)

EMBL: CP000431.PE246

CP000431.PE246       Location/Qualifiers
FT   CDS             317859..318542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00246"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00246"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92082"
FT                   /db_xref="GOA:Q0SK54"
FT                   /db_xref="InterPro:IPR011737"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK54"
FT                   /protein_id="ABG92082.1"
FT                   /translation="MFSSDREFTAYGPSYWAMIALFVVGAAVLVRLGRRQTESQARRLG
FT                   RVLAVLTAAIYGATLVHFSIPPTIGGSVPLRLTDLATVAAACALWSRAQWAYALTYYWG
FT                   LVLSTQALISPVLTGPDFPHYQFLAFWAIHLLVVWAAIYLTWGRGMRPRWRSYRFTVLV
FT                   TVVWAAVTFTFNRVAGTNYGFLNRKPATATLLDVLGPWPVYLLTATTLILVVWALMTWP
FT                   WERTR"
     MFSSDREFTA YGPSYWAMIA LFVVGAAVLV RLGRRQTESQ ARRLGRVLAV LTAAIYGATL        60
     VHFSIPPTIG GSVPLRLTDL ATVAAACALW SRAQWAYALT YYWGLVLSTQ ALISPVLTGP       120
     DFPHYQFLAF WAIHLLVVWA AIYLTWGRGM RPRWRSYRFT VLVTVVWAAV TFTFNRVAGT       180
     NYGFLNRKPA TATLLDVLGP WPVYLLTATT LILVVWALMT WPWERTR                     227
//

If you have problems or comments...

PBIL Back to PBIL home page