(data stored in ACNUC7421 zone)

EMBL: CP000431.PE247

CP000431.PE247       Location/Qualifiers
FT   CDS             318672..319661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00247"
FT                   /product="rod shaping protein, MreB"
FT                   /note="GO_function: GO:0005524 - ATP binding; GO_function:
FT                   GO:0051082 - unfolded protein binding; GO_process:
FT                   GO:0000902 - cellular morphogenesis; GO_process: GO:0006457
FT                   - protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00247"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92083"
FT                   /db_xref="GOA:Q0SK53"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK53"
FT                   /protein_id="ABG92083.1"
FT                   /translation="MGGLGIDLGTANTVVGTPDDGIVLNEPSFMLVRTKDPHRALAIGT
FT                   EARSLVGRTPIGITPVRPMRDGVIVDLESARAFVTAVIKRVSSARRYGLRPKAVISVPA
FT                   GATPLERRALLEVGHEAGLRKVGLVPEPVAGALGCGINPMEPRAHLVVDIGGGTSEVTA
FT                   ICFGGILSHRSCRVAGDELTNALYQYLRAEHKIVVGELTAERAKLGEPDSAEGQSLVVE
FT                   GRDAVTGRARLVTLETEEIVEALRPTTTGIVQTLTECLDDLPAQAIGDVMSEGLLVIGG
FT                   GALLRGLSQLLEESFGFPVKTAERPLTCVAEGATACLVHPEVVAAYSA"
     MGGLGIDLGT ANTVVGTPDD GIVLNEPSFM LVRTKDPHRA LAIGTEARSL VGRTPIGITP        60
     VRPMRDGVIV DLESARAFVT AVIKRVSSAR RYGLRPKAVI SVPAGATPLE RRALLEVGHE       120
     AGLRKVGLVP EPVAGALGCG INPMEPRAHL VVDIGGGTSE VTAICFGGIL SHRSCRVAGD       180
     ELTNALYQYL RAEHKIVVGE LTAERAKLGE PDSAEGQSLV VEGRDAVTGR ARLVTLETEE       240
     IVEALRPTTT GIVQTLTECL DDLPAQAIGD VMSEGLLVIG GGALLRGLSQ LLEESFGFPV       300
     KTAERPLTCV AEGATACLVH PEVVAAYSA                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page