(data stored in ACNUC7421 zone)

EMBL: CP000431.PE248

CP000431.PE248       Location/Qualifiers
FT   CDS             complement(319662..322505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RHA1_ro00248"
FT                   /product="cell division protein"
FT                   /note="GO_function: GO:0003674 - molecular_function;
FT                   GO_process: GO:0009273 - cell wall biosynthesis (sensu
FT                   Bacteria)"
FT                   /db_xref="EnsemblGenomes-Gn:RHA1_ro00248"
FT                   /db_xref="EnsemblGenomes-Tr:ABG92084"
FT                   /db_xref="GOA:Q0SK52"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:Q0SK52"
FT                   /protein_id="ABG92084.1"
FT                   /translation="MHDDKHDDKHESDPWIVGAAIVLVVLGLLNLLSTGKTADAVRHTL
FT                   FAVAGLGIMYVVSRLRMSDLRAFGWAVFTVATVLLAVVPFAGVATKGAQRWLDFGVFTV
FT                   QPSELAKLALVLVPASMLAGGFTLARFVATLAIVGVPIALVALQPDLSTAVVLVATAGF
FT                   MLILARVPLLPLVPLFVLGLASLPLAVLFLRPYQLERVHVFLSSNADPAGAGWAELQAN
FT                   IAIGSGGLWGLARDPMYAVRAEYLPESEHDLAFASLVYGWGLIAGLAVVVATSVIVWRA
FT                   ALSARTARTREAALVAAGIGALFGIHALVSIGQSLSLLPHTGMPIPLFSYGGTAAIVGF
FT                   VAIGLVLAVRRDGVARPLWTPDPRRRRRPRGMSAGTLTMTAALVAMSVFAWQLQHDRGA
FT                   EFRAMSDQQMMRCIRLPAERGLILDRNGVPLAVNVAEYAVAVVARMFDEHDDDARNRLA
FT                   AVLARSPDEVADLIDAGGEGESQVEVGRVAPDQARRIVDARLPGVLVVPTGRRQYPYGA
FT                   VLASVLGHVGVADADDMERWPHLALGSRVGKAGLEKQYDALLRGSDGKQCMYVDPSGHP
FT                   VAAGERVDPVRGHDLRLHLDIEVQNLATDALVEAMRTSKGDLGAAVVMDARNGAVLALA
FT                   SVPGADNNVYGPPADLVALAAQSQTPGPSPLLNNATQTAVPPGSTFKIVVAAANTRYPV
FT                   LSPDAVIDTGAAYTYGGHTFRNWQPMGPHNLLQAIQWSDNVYFYKLGELLGPERMADVA
FT                   GQLGVGRRSGIDLPGEAEGFLGTPENVGSIGATWYPGSTLLMGIGQGTVSATPIQVARW
FT                   TSGIATGAMVTPQLAAAYGSELTPIPTAEPQRLPFADLLGPVRAGMRASASAGTAGQLA
FT                   DLPVPAGAKTGTAEDPSAPGEGLNAWFSAVAPFDAPQIQVSVLIRGGGFGSATAGPVVK
FT                   KLLEHYFPRPPAPAPTR"
     MHDDKHDDKH ESDPWIVGAA IVLVVLGLLN LLSTGKTADA VRHTLFAVAG LGIMYVVSRL        60
     RMSDLRAFGW AVFTVATVLL AVVPFAGVAT KGAQRWLDFG VFTVQPSELA KLALVLVPAS       120
     MLAGGFTLAR FVATLAIVGV PIALVALQPD LSTAVVLVAT AGFMLILARV PLLPLVPLFV       180
     LGLASLPLAV LFLRPYQLER VHVFLSSNAD PAGAGWAELQ ANIAIGSGGL WGLARDPMYA       240
     VRAEYLPESE HDLAFASLVY GWGLIAGLAV VVATSVIVWR AALSARTART REAALVAAGI       300
     GALFGIHALV SIGQSLSLLP HTGMPIPLFS YGGTAAIVGF VAIGLVLAVR RDGVARPLWT       360
     PDPRRRRRPR GMSAGTLTMT AALVAMSVFA WQLQHDRGAE FRAMSDQQMM RCIRLPAERG       420
     LILDRNGVPL AVNVAEYAVA VVARMFDEHD DDARNRLAAV LARSPDEVAD LIDAGGEGES       480
     QVEVGRVAPD QARRIVDARL PGVLVVPTGR RQYPYGAVLA SVLGHVGVAD ADDMERWPHL       540
     ALGSRVGKAG LEKQYDALLR GSDGKQCMYV DPSGHPVAAG ERVDPVRGHD LRLHLDIEVQ       600
     NLATDALVEA MRTSKGDLGA AVVMDARNGA VLALASVPGA DNNVYGPPAD LVALAAQSQT       660
     PGPSPLLNNA TQTAVPPGST FKIVVAAANT RYPVLSPDAV IDTGAAYTYG GHTFRNWQPM       720
     GPHNLLQAIQ WSDNVYFYKL GELLGPERMA DVAGQLGVGR RSGIDLPGEA EGFLGTPENV       780
     GSIGATWYPG STLLMGIGQG TVSATPIQVA RWTSGIATGA MVTPQLAAAY GSELTPIPTA       840
     EPQRLPFADL LGPVRAGMRA SASAGTAGQL ADLPVPAGAK TGTAEDPSAP GEGLNAWFSA       900
     VAPFDAPQIQ VSVLIRGGGF GSATAGPVVK KLLEHYFPRP PAPAPTR                     947
//

If you have problems or comments...

PBIL Back to PBIL home page